Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_018370937.1 BN415_RS02530 ATP-binding cassette domain-containing protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_000341525.1:WP_018370937.1 Length = 250 Score = 186 bits (473), Expect = 3e-52 Identities = 102/254 (40%), Positives = 156/254 (61%), Gaps = 5/254 (1%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 ++ N+ S+G +L+D+ L +PTGK TA IGPNG GKSTLL SRLL G + + Sbjct: 1 MKLVNIHKSFGKTLILDDIELQIPTGKFTAFIGPNGAGKSTLLAIMSRLLDKDQGILTIK 60 Query: 63 DNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVA 122 I +S++LA+ L++L Q +TV+ELVS+GR P+ RL++ED+ ++ +A Sbjct: 61 GTEIEAWNSKELAKELTILKQKINYQAKLTVEELVSFGRFPYSR--DRLTSEDHEKIELA 118 Query: 123 MNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMG 182 + I L R + LSGGQ QR F+AMVLAQ+T +LLDEP LDI + +M+++ Sbjct: 119 LRHLNILELRERMIDTLSGGQLQRVFIAMVLAQDTDFILLDEPLNNLDIKQSIGMMKILR 178 Query: 183 ELRTQ-GKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEI 241 L + GKT++ V+HD+N AS+Y DQ+V +G V AQG+ ++M +L ++ +E I Sbjct: 179 SLVDELGKTIIIVIHDINIASQYVDQMVAFKDGKVFAQGSTYDMMQTQILNPLYDMEMTI 238 Query: 242 HPEPVSGRPMCLMR 255 + G +C+ R Sbjct: 239 --GEIDGTRICIYR 250 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 250 Length adjustment: 24 Effective length of query: 231 Effective length of database: 226 Effective search space: 52206 Effective search space used: 52206 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory