Align PTS system, IIA component, component of The gluconate PTS uptake system. IIAGnt and IIBGnt form a high affinity 2:2 heterotetrameric complex (characterized)
to candidate WP_018370772.1 BN415_RS05235 PTS mannose transporter subunit IIAB
Query= TCDB::Q82ZC8 (150 letters) >NCBI__GCF_000341525.1:WP_018370772.1 Length = 329 Score = 71.2 bits (173), Expect = 1e-17 Identities = 39/133 (29%), Positives = 69/133 (51%), Gaps = 5/133 (3%) Query: 2 LGIVIATHGALSDGAKDAATVIMGATENIETVNLNSGDDVQALGGQIKTAIENVQQGDGV 61 +GI+IA+HG + G + ++I G E ++ V + L + A+ D V Sbjct: 3 IGIIIASHGEFASGIHQSGSMIFGDQEKVQVVTFMPSEGPDDLYAKFNNAVAAFDADDEV 62 Query: 62 LVMVDLLSASPYNQAVLVINELEPALQKKIFVVSGTNLPMVLEAINHQLL--GTPIAEAA 119 LV+ DL S SP+NQA V+ E +K +++G NLPM+++A +++ + A Sbjct: 63 LVLADLWSGSPFNQASRVMGENP---DRKFAIITGLNLPMLIQAYTERMMDANAGVEAVA 119 Query: 120 QAIVAQGKESVQA 132 I+ + K+ V+A Sbjct: 120 ANIIKEAKDGVKA 132 Lambda K H 0.312 0.130 0.350 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 105 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 150 Length of database: 329 Length adjustment: 22 Effective length of query: 128 Effective length of database: 307 Effective search space: 39296 Effective search space used: 39296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory