Align PTS system mannose-specific EIIAB component; EC 2.7.1.-; EC 2.7.1.69 (characterized)
to candidate WP_018370772.1 BN415_RS05235 PTS mannose transporter subunit IIAB
Query= CharProtDB::CH_088329 (323 letters) >NCBI__GCF_000341525.1:WP_018370772.1 Length = 329 Score = 239 bits (609), Expect = 9e-68 Identities = 133/329 (40%), Positives = 192/329 (58%), Gaps = 13/329 (3%) Query: 1 MTIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTK 60 M+I I+I +HG A + ++ M+ G+QE V + F+P E + L K+N +A D Sbjct: 1 MSIGIIIASHGEFASGIHQSGSMIFGDQEKVQVVTFMPSEGPDDLYAKFNNAVAAFDADD 60 Query: 61 GVLFLVDTWGGSPFNAASRIVVDK--EHYEVIAGVNIPMLVETLMAR--DDDPSFDELVA 116 VL L D W GSPFN ASR++ + + +I G+N+PML++ R D + + + A Sbjct: 61 EVLVLADLWSGSPFNQASRVMGENPDRKFAIITGLNLPMLIQAYTERMMDANAGVEAVAA 120 Query: 117 LAVETGREGVKALKAKPVEKAAPAPAAAAPKAAPTP--AKPMGP---NDYMVIGLARIDD 171 ++ ++GVKAL E+ PA A AAP A P G + + I LARID Sbjct: 121 NIIKEAKDGVKALP----EELNPAEVTATNAAAPVAQTAIPEGTVIGDGKLKINLARIDT 176 Query: 172 RLIHGQVATRWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVDVAKMIRVYN 231 RL+HGQVAT WT ++ RIIV SD V+ D++RK L+ Q AP V A+VV + K+I Sbjct: 177 RLLHGQVATAWTPDSKADRIIVASDSVSQDSLRKELIKQAAPGNVKANVVPIDKLIAAAK 236 Query: 232 NPKYAGERVMLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVNNAVSVDEKDIEAF 291 +P++ G ++LF P D R +EGGV I ++NVG MA GKT VNN +S+D+ D+ F Sbjct: 237 DPRFGGTHALILFETPQDALRAIEGGVPIKTLNVGSMAHSTGKTMVNNVLSMDKDDVATF 296 Query: 292 KKLNARGIELEVRKVSTDPKLKMMDLISK 320 +KL G+ +VRKV D K + DLI+K Sbjct: 297 EKLRDLGVTFDVRKVPNDSKKDLFDLINK 325 Lambda K H 0.316 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 329 Length adjustment: 28 Effective length of query: 295 Effective length of database: 301 Effective search space: 88795 Effective search space used: 88795 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory