Align Glycerol dehydrogenase; GDH; GLDH; GlyDH; EC 1.1.1.6 (characterized)
to candidate WP_018371638.1 BN415_RS08265 glycerol dehydrogenase
Query= SwissProt::P32816 (370 letters) >NCBI__GCF_000341525.1:WP_018371638.1 Length = 363 Score = 400 bits (1027), Expect = e-116 Identities = 201/362 (55%), Positives = 266/362 (73%), Gaps = 1/362 (0%) Query: 5 RVFISPAKYVQGKNVITKIANYLEGIGNKTVVIADEIVWKIAGHTIVNELKKGNIAAEEV 64 + F SP++YVQG+N + + A L +GN +++ D++V+++ G L + V Sbjct: 2 KYFASPSRYVQGENALFENAKPLLKLGNHPLLLCDDLVYELVGERFEEYLIRYGFQVHHV 61 Query: 65 VFSGEASRNEVERIANIARKAEAAIVIGVGGGKTLDTAKAVADELDAYIVIVPTAASTDA 124 F+GEAS E+ R+ +A + + ++IG+GGGKT+D+AKA+AD L +VI PT ASTDA Sbjct: 62 AFNGEASEKEITRVVALAEEKKNDMIIGLGGGKTIDSAKAIADMLKVPVVIAPTIASTDA 121 Query: 125 PTSALSVIYSDDGVFESYRFYKKNPDLVLVDTKIIANAPPRLLASGIADALATWVEARSV 184 PTSALSVIY++DG FE Y FY +NPDLVLVD+ +IA AP RLLASGIADALATWVEAR+V Sbjct: 122 PTSALSVIYTEDGAFEKYIFYSRNPDLVLVDSAVIAKAPKRLLASGIADALATWVEARAV 181 Query: 185 IKSGGKTMAGGIPTIAAEAIAEKCEQTLFKYGKLAYESVKAKVVTPALEAVVEANTLLSG 244 ++ G+ M G T+A AIA+KCE+TLF G A + + +VVTPAL+ ++EANTLLSG Sbjct: 182 KEAHGQNMLGAKQTLAGLAIAQKCEETLFADGLQAMAACEVQVVTPALDNIIEANTLLSG 241 Query: 245 LGFESGGLAAAHAIHNGFTALEGEIHHLTHGEKVAFGTLVQLALEEHSQQEIERYIELYL 304 +GFESGGLAAAHAIHNGFTAL G+IHHLTHGEKVA+GTLVQL LE ++E+++YI Y Sbjct: 242 VGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLVQLFLENRPKEELDKYIRFYQ 301 Query: 305 SLDLPVTLEDIKLKDASREDILKVAKAATAEGETIHN-AFNVTADDVADAIFAADQYAKA 363 + +P TL ++ L++AS +D+LKV K AT EGETIH F VTA D+A+AI A D Y K Sbjct: 302 KIQMPTTLAELHLENASYQDLLKVGKQATIEGETIHQMPFKVTATDIANAILAVDAYVKT 361 Query: 364 YK 365 K Sbjct: 362 LK 363 Lambda K H 0.314 0.131 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 363 Length adjustment: 30 Effective length of query: 340 Effective length of database: 333 Effective search space: 113220 Effective search space used: 113220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory