Align ABC transporter substrate-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_018371597.1 BN415_RS07295 ABC transporter substrate-binding protein
Query= TCDB::Q8DQI1 (386 letters) >NCBI__GCF_000341525.1:WP_018371597.1 Length = 385 Score = 545 bits (1404), Expect = e-160 Identities = 268/386 (69%), Positives = 326/386 (84%), Gaps = 1/386 (0%) Query: 1 MKKKFALSFVALASVALLAACGEVKSGAVNTAGNSVEEKTIKIGFNFEESGSLAAYGTAE 60 MKKK A+S + LAS+A L ACG V +G N+ + +KT+KIG N EE+G+ AYG+AE Sbjct: 1 MKKKVAISIMTLASIAFLTACGNVSTGNSNSTTGTPIDKTVKIGINLEETGATGAYGSAE 60 Query: 61 QKGAQLAVDEINAAGGIDGKQIEVVDKDNKSETAEAASVTTNLVTQSKVSAVVGPATSGA 120 Q+GA+LA++EIN AGG+DGK++EV D DNKSETAEA +V++ LV+Q KV+ ++GPATSGA Sbjct: 61 QRGAKLAIEEINNAGGVDGKKLEVKDYDNKSETAEATNVSSKLVSQDKVNVMIGPATSGA 120 Query: 121 TAAAVANATKAGVPLISPSATQDGLTKGQDYLFIGTFQDSFQGKIISNYVSEKLNAKKVV 180 TAAAV NA KAGVPLI+PSA+QDGLTKG DYLF+ FQDSFQGKI++ Y ++ LNAKKV+ Sbjct: 121 TAAAVKNADKAGVPLITPSASQDGLTKGHDYLFVTIFQDSFQGKILAKY-ADTLNAKKVI 179 Query: 181 LYTDNASDYAKGIAKSFRESYKGEIVADETFVAGDTDFQAALTKMKGKDFDAIVVPGYYN 240 LYTDN SDYAKGIAK+FR++YKGEIVADETF AGDTDFQAALTK+K KDFDAIV+PGYY Sbjct: 180 LYTDNGSDYAKGIAKAFRDAYKGEIVADETFTAGDTDFQAALTKLKNKDFDAIVIPGYYT 239 Query: 241 EAGKIVNQARGMGIDKPIVGGDGFNGEEFVQQATAEKASNIYFISGFSTTVEVSAKAKAF 300 EAGKIVNQARGMGI+KPI+G DGFN E FVQQATAE+A+NIY+++GFSTT +++ K K F Sbjct: 240 EAGKIVNQARGMGIEKPILGPDGFNSEAFVQQATAERANNIYYVTGFSTTGDMTEKTKKF 299 Query: 301 LDAYRAKYNEEPSTFAALAYDSVHLVANAAKGAKNSGEIKNNLAKTKDFEGVTGQTSFDA 360 L+AY+AKYNEEPS FAALAYDSV++ A AAKGAK S +I NNLAK KDFEGVTG+ + D Sbjct: 300 LEAYKAKYNEEPSMFAALAYDSVYMAAEAAKGAKTSVDINNNLAKLKDFEGVTGKMTIDK 359 Query: 361 DHNTVKTAYMMTMNNGKVEAAEVVKP 386 DHNT K+A M+TMN GKVE E V+P Sbjct: 360 DHNTEKSALMVTMNGGKVEKVETVEP 385 Lambda K H 0.310 0.126 0.337 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 512 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 385 Length adjustment: 30 Effective length of query: 356 Effective length of database: 355 Effective search space: 126380 Effective search space used: 126380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory