Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate WP_018371255.1 BN415_RS02000 alpha-ketoacid dehydrogenase subunit beta
Query= metacyc::MONOMER-11684 (327 letters) >NCBI__GCF_000341525.1:WP_018371255.1 Length = 330 Score = 302 bits (774), Expect = 7e-87 Identities = 159/323 (49%), Positives = 217/323 (67%), Gaps = 4/323 (1%) Query: 3 VMSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAESA 62 +MS+ D I LAM EEM RD V ++GEDVG GG F + G+ E+FG ERV D P++E+A Sbjct: 5 LMSFRDTIILAMSEEMRRDENVLLMGEDVGVFGGDFGTSVGMLEEFGPERVRDCPISEAA 64 Query: 63 IAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYGGG 122 I+G GAAM G+RPI +M F DF + A++ I+++AAK RY P+ +R G G Sbjct: 65 ISGAAAGAAMTGLRPIVDMTFMDFSVIAMDAIVNQAAKTRYMFGGKGQVPMTIRCAAGNG 124 Query: 123 VHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLIKG 182 V A HSQS+E+ F + PGLK+V P TP D KGLLK+A+RD +PV+F E+K + KG Sbjct: 125 VGSAAQHSQSLESWFTHIPGLKVVAPGTPADYKGLLKSAIRDNNPVIFLEYKSEFNQ-KG 183 Query: 183 EVPAD-DYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVYP 241 EVP D DY +P+G ++K+EG D+TV+TYG + +QAAE L ++GIS VVD RT+ P Sbjct: 184 EVPLDPDYTIPLGVGEIKKEGTDVTVVTYGKMLRRVMQAAEELAEEGISVEVVDPRTLVP 243 Query: 242 LDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFD-LDAPIKRLAGPDIPAM 300 LDK+ II + KTGKV+LV + K + E++AIISE FD LDAPI+R AG D+P M Sbjct: 244 LDKDIIINSVKKTGKVVLVNDAHKTSGYIGELSAIISESEAFDYLDAPIRRCAGEDVP-M 302 Query: 301 PYAPTMEKYFMVNPDKVEAAMRE 323 PYA +E + D ++ A+R+ Sbjct: 303 PYAQNLENAMIPTVDSIKDAIRK 325 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 330 Length adjustment: 28 Effective length of query: 299 Effective length of database: 302 Effective search space: 90298 Effective search space used: 90298 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory