Align PTS system fructose-specific EIIB component; EIIB-Fru; Fructose-specific phosphotransferase enzyme IIB component; lev-PTS; p18; EC 2.7.1.202 (characterized)
to candidate WP_018370772.1 BN415_RS05235 PTS mannose transporter subunit IIAB
Query= SwissProt::P26380 (163 letters) >NCBI__GCF_000341525.1:WP_018370772.1 Length = 329 Score = 142 bits (359), Expect = 4e-39 Identities = 68/157 (43%), Positives = 97/157 (61%) Query: 2 MNIVLARIDDRFIHGQILTRWIKVHAADRIIVVSDDIAQDEMRKTLILSVAPSNVKASAV 61 + I LARID R +HGQ+ T W ADRIIV SD ++QD +RK LI AP NVKA+ V Sbjct: 167 LKINLARIDTRLLHGQVATAWTPDSKADRIIVASDSVSQDSLRKELIKQAAPGNVKANVV 226 Query: 62 SVSKMAKAFHSPRYEGVTAMLLFENPSDIVSLIEAGVPIKTVNVGGMRFENHRRQITKSV 121 + K+ A PR+ G A++LFE P D + IE GVPIKT+NVG M + + + Sbjct: 227 PIDKLIAAAKDPRFGGTHALILFETPQDALRAIEGGVPIKTLNVGSMAHSTGKTMVNNVL 286 Query: 122 SVTEQDIKAFETLSDKGVKLELRQLPSDASEDFVQIL 158 S+ + D+ FE L D GV ++R++P+D+ +D ++ Sbjct: 287 SMDKDDVATFEKLRDLGVTFDVRKVPNDSKKDLFDLI 323 Lambda K H 0.320 0.133 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 329 Length adjustment: 23 Effective length of query: 140 Effective length of database: 306 Effective search space: 42840 Effective search space used: 42840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory