GapMind for catabolism of small carbon sources

 

Protein WP_008431290.1 in Planococcus halocryophilus Or1

Annotation: NCBI__GCF_000342445.1:WP_008431290.1

Length: 214 amino acids

Source: GCF_000342445.1 in NCBI

Candidate for 24 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism Ac3H11_2554 lo ABC transporter for L-Histidine, permease component 1 (characterized) 39% 91% 152.9 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-asparagine catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 36% 96% 142.5 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-aspartate catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 36% 96% 142.5 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-glutamate catabolism gltK lo Glutamate/aspartate import permease protein GltK (characterized) 36% 96% 142.5 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-asparagine catabolism natH lo NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 38% 54% 136 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-aspartate catabolism natH lo NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 38% 54% 136 Basic amino acid uptake transporter, BgtAB 42% 176.8
D-glucosamine (chitosamine) catabolism AO353_21715 lo ABC transporter for D-Glucosamine, permease component 2 (characterized) 35% 94% 135.6 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-lysine catabolism hisQ lo ABC transporter for L-Lysine, permease component 1 (characterized) 33% 88% 131.7 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-arginine catabolism artM lo L-Arginine ABC transporter, permease protein AotM (characterized) 33% 94% 130.6 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-asparagine catabolism peb1B lo PEP1B, component of Uptake system for glutamate and aspartate (characterized) 35% 81% 130.2 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-aspartate catabolism peb1B lo PEP1B, component of Uptake system for glutamate and aspartate (characterized) 35% 81% 130.2 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-glutamate catabolism peb1B lo PEP1B, component of Uptake system for glutamate and aspartate (characterized) 35% 81% 130.2 Basic amino acid uptake transporter, BgtAB 42% 176.8
D-glucosamine (chitosamine) catabolism AO353_21720 lo ABC transporter for D-glucosamine, permease component 2 (characterized) 32% 92% 122.1 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-arginine catabolism artQ lo ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized) 31% 93% 120.6 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-citrulline catabolism AO353_03050 lo ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized) 31% 93% 120.6 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-glutamate catabolism gluD lo GluD aka CGL1953, component of Glutamate porter (characterized) 30% 75% 110.5 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-histidine catabolism hisQ lo Histidine transport system permease protein HisQ (characterized) 31% 93% 109.8 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-asparagine catabolism aatQ lo ABC transporter for L-asparagine and L-glutamate, permease component 1 (characterized) 30% 88% 109 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-aspartate catabolism aatQ lo ABC transporter for L-asparagine and L-glutamate, permease component 1 (characterized) 30% 88% 109 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-glutamate catabolism gltJ lo ABC transporter for L-asparagine and L-glutamate, permease component 1 (characterized) 30% 88% 109 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-asparagine catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 31% 74% 107.5 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-aspartate catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 31% 74% 107.5 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-asparagine catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 31% 51% 77.4 Basic amino acid uptake transporter, BgtAB 42% 176.8
L-aspartate catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 31% 51% 77.4 Basic amino acid uptake transporter, BgtAB 42% 176.8

Sequence Analysis Tools

View WP_008431290.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MDTIINAFPYLMEGLKVTLYIFAIAIVLGFLIGLIVALFRLAPLKILNWIAKIFVDAIRG
TPFIVQLFFIYFGLNSLAFISLDNTTAGIVTVAINAGAYFSEIIRAGIQSIDKGQTEAAR
SLGLNSTQNMRYIVLPQAFRRMLPTITNQAIISLKDTSLLSVIGVADLTQEGRIQASATF
DAFNVYLILGIIYFVVIYLLSMLANYVERKFVLR

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory