GapMind for catabolism of small carbon sources

 

Alignments for a candidate for adiA in Planococcus halocryophilus Or1

Align Arginine decarboxylase proenzyme; ADC; ArgDC; EC 4.1.1.19; Pyruvoyl-dependent arginine decarboxylase (uncharacterized)
to candidate WP_008496469.1 B481_RS02560 S-adenosylmethionine decarboxylase proenzyme

Query= curated2:C3N6F7
         (134 letters)



>NCBI__GCF_000342445.1:WP_008496469.1
          Length = 127

 Score = 73.2 bits (178), Expect = 1e-18
 Identities = 36/99 (36%), Positives = 62/99 (62%), Gaps = 3/99 (3%)

Query: 21  IGKHVFGNLYDIDAERLNDKEFLEKLVLEAVNIAHMKLVEIKAWSFGGKKGGVSVIALVE 80
           +G+HV   L+  D ++LND +F+E+  ++A   +  ++ E+    F  +  GVS + ++ 
Sbjct: 4   MGRHVIAELWQCDFDKLNDMDFIEQTFVDAALKSGAEVREVAFHKFAPQ--GVSGVVIIS 61

Query: 81  ESHIALHTWNEYNYATLDVYTCGEDSDPQSAFAHIVNAL 119
           ESH+ +H++ E+ YA++DVYTCG D DP  A  +I  AL
Sbjct: 62  ESHLTIHSFPEHGYASVDVYTCG-DLDPTIAAEYIAEAL 99


Lambda     K      H
   0.315    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 49
Number of extensions: 2
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 134
Length of database: 127
Length adjustment: 14
Effective length of query: 120
Effective length of database: 113
Effective search space:    13560
Effective search space used:    13560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 41 (20.4 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory