Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate WP_008498227.1 B481_RS11735 ABC transporter ATP-binding protein
Query= CharProtDB::CH_003736 (237 letters) >NCBI__GCF_000342445.1:WP_008498227.1 Length = 248 Score = 97.1 bits (240), Expect = 3e-25 Identities = 65/199 (32%), Positives = 107/199 (53%), Gaps = 3/199 (1%) Query: 17 KIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVFDDKDITDWQT-A 75 K AL SL I +GE+++++G +G+GK+T+L L G + G++ D+ + D +T Sbjct: 16 KAVALDNFSLEIEKGEVISILGRSGSGKSTVLRLLAGLENPSVGKVTIQDQVLCDNKTFI 75 Query: 76 KIMREAVAIVPEGRRVFSRMTVEENLAMGGFFAERDQFQERIKWVYELFPRLHERRIQRA 135 + + + +V + +F MTV N+ G F ++ Q+R++ V EL L + Sbjct: 76 QPEKRGIGMVFQDYALFPHMTVANNILFGLFRMKKSAKQQRLQEVLELV-ELQGYENRYP 134 Query: 136 GTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIEQ-LREQGMTIFLVE 194 +SGG+QQ +AI RAL NP LLLLDEP L + ++I + L++ +T V Sbjct: 135 HQLSGGQQQRVAIARALAPNPHLLLLDEPFSNLDAELQEKIRKELRDILKKANITSIFVT 194 Query: 195 QNANQALKLADRGYVLENG 213 + A LADR ++NG Sbjct: 195 HDEKDAHILADRIVKIKNG 213 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 248 Length adjustment: 23 Effective length of query: 214 Effective length of database: 225 Effective search space: 48150 Effective search space used: 48150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory