Align Proline dehydrogenase 2; PRODH 2; Proline oxidase 2; EC 1.5.5.2 (characterized)
to candidate WP_008498617.1 B481_RS13765 proline dehydrogenase family protein
Query= SwissProt::P94390 (303 letters) >NCBI__GCF_000342445.1:WP_008498617.1 Length = 302 Score = 297 bits (760), Expect = 2e-85 Identities = 143/302 (47%), Positives = 208/302 (68%), Gaps = 2/302 (0%) Query: 2 ITRDFFLFLSKSGFLNKMARNWGSRVAAGKIIGGNDFNSSIPTIRQLNSQGLSVTVDHLG 61 +T++FF+ LSK+ LN A+ WG ++ AGK++ G D S + ++++LN+ G+S T+D LG Sbjct: 3 VTKNFFIALSKNQPLNSAAKKWGLKLGAGKVVAGTDIASMMQSVKELNANGISATIDSLG 62 Query: 62 EFVNSAEVARERTEECIQTIATIADQELNSHVSLKMTSLGLDIDMDLVYENMTKILQTAE 121 EFV++ E A + E I+T+ +I +N+H+S+K+T +GLD+D D +N+ +IL A Sbjct: 63 EFVHTKEEATKAKEAIIKTLESIQIYGVNAHMSVKLTQIGLDVDFDFCLKNIQEILAEAS 122 Query: 122 KHKIMVTIDMEDEVRCQKTLDIFKDFRKKYEHVSTVLQAYLYRTEKDIDDLDSLNPFLRL 181 ++ I + +DMED Q+TLDI + R +YE+V TV+QAYLYR+EKD++ L + LRL Sbjct: 123 RYDIFINLDMEDYDHLQQTLDILEALRAEYENVGTVIQAYLYRSEKDLETLKDVR--LRL 180 Query: 182 VKGAYKESEKVAFPEKSDVDENYKKIIRKQLLNGHYTAIATHDDKMIDFTKQLAKEHGIA 241 VKGAYKES +V+F EK +VDENY K+I+ L + +T+IATHD +I+ K KE I Sbjct: 181 VKGAYKESSEVSFQEKHEVDENYLKLIKIHLQSPGFTSIATHDHHIIEKVKAFVKEENIP 240 Query: 242 NDKFEFQMLYGMRSQTQLSLVKEGYNMRVYLPYGEDWYGYFMRRLAERPSNIAFAFKGMT 301 ++FEFQMLYG RS+ Q L KEGY Y+P+G+DWY Y+MRRLAERP NI + M Sbjct: 241 LNRFEFQMLYGFRSEMQKDLAKEGYAFTTYVPFGQDWYAYYMRRLAERPQNINLMLRSMI 300 Query: 302 KK 303 K Sbjct: 301 SK 302 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 302 Length adjustment: 27 Effective length of query: 276 Effective length of database: 275 Effective search space: 75900 Effective search space used: 75900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory