Align mannose permease IIC component (characterized)
to candidate WP_007477148.1 LFLEISCH_RS12580 PTS mannose/fructose/sorbose transporter subunit IIC
Query= CharProtDB::CH_088330 (266 letters) >NCBI__GCF_000344175.1:WP_007477148.1 Length = 271 Score = 381 bits (979), Expect = e-111 Identities = 193/270 (71%), Positives = 228/270 (84%), Gaps = 6/270 (2%) Query: 3 ITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIALG 62 +T +Q+VLVF+V+C++GMGSILDE+Q HRPLIACTL+G+VLGD+ TGIIIGGTLEMIALG Sbjct: 1 MTAIQLVLVFLVSCVSGMGSILDEWQTHRPLIACTLIGLVLGDITTGIIIGGTLEMIALG 60 Query: 63 WMNIGAAVAPDAALASIISTILVIAGHQSIGAGIALAIPLAAAGQVLTIIVRTITVAFQH 122 WMNIGAAVAPDAALASIISTILVI G Q I GI+LAIPLAA GQVLTI+VRTITVAFQH Sbjct: 61 WMNIGAAVAPDAALASIISTILVITGGQDISVGISLAIPLAALGQVLTILVRTITVAFQH 120 Query: 123 AADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVALSVGTSEVQNMLNAIPEVVTNGL 182 ADKA GNL ++ WIHV++L LQAMR+AIPA+IVA++VGT V NMLNAIP V+ NGL Sbjct: 121 MADKAGKAGNLRSLDWIHVTALLLQAMRIAIPALIVAVTVGTDAVTNMLNAIPSVIVNGL 180 Query: 183 NIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFNLVALGVIGTVMAVLYIQLS 242 N+AGG IVVVGYAMVINMM+A YLMPFF+LGFV AAFT FNLVALGV+G V A++YIQL+ Sbjct: 181 NVAGGFIVVVGYAMVINMMQAKYLMPFFFLGFVVAAFTAFNLVALGVLGLVAAIIYIQLN 240 Query: 243 PKY------NRVAGAPAQAAGNNDLDNELD 266 PKY + G + ++DLD++LD Sbjct: 241 PKYQLKAAIEQYGGGGGKRQSDDDLDDDLD 270 Lambda K H 0.326 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 271 Length adjustment: 25 Effective length of query: 241 Effective length of database: 246 Effective search space: 59286 Effective search space used: 59286 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory