Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_017730539.1 F752_RS0104500 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_000346615.1:WP_017730539.1 Length = 339 Score = 135 bits (341), Expect = 8e-37 Identities = 90/255 (35%), Positives = 140/255 (54%), Gaps = 9/255 (3%) Query: 2 TLRTENLTVSYGTDK----VLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSG 57 TL+ + L++ Y K V + L + G++ L+GPNG GKSTLL + + P +G Sbjct: 7 TLQAQQLSIGYRNKKADKIVRAGLDLEVYQGELLCLMGPNGAGKSTLLRTLAGVQEPLAG 66 Query: 58 TVFLGDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNA 117 V + PI+ L+ ++ ARR+SL+ L+ + V ELV+ GR P G LS D Sbjct: 67 QVIMEGQPIHQLAQQERARRISLVLTEQLSAGNMNVLELVALGRYPHTGWGGSLSPADKE 126 Query: 118 RVNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDL 177 V A+N I LA R+L ELS GQRQ+A +A LAQ+ +++LDEPT +LD+ +++ + Sbjct: 127 MVLQALNDLDIGELAGRKLYELSDGQRQKAMIARALAQDGQLMILDEPTAHLDLINRLQI 186 Query: 178 MRLMG--ELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHV-MAQGTPEEVMTPGLLRTV 234 MR + LR Q K ++ H+L A + D+L ++ G PE+++ G L Sbjct: 187 MRQLRLLALRRQ-KAILVATHELELALQSADRLWLLPQEQEGFLAGMPEDLVLNGSLAKA 245 Query: 235 FSVEAEIHPEPVSGR 249 F+ + H + SGR Sbjct: 246 FN-RSGFHFDLSSGR 259 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 339 Length adjustment: 26 Effective length of query: 229 Effective length of database: 313 Effective search space: 71677 Effective search space used: 71677 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory