GapMind for catabolism of small carbon sources

 

Protein WP_051056359.1 in Lactobacillus pobuzihii E100301

Annotation: NCBI__GCF_000349725.1:WP_051056359.1

Length: 470 amino acids

Source: GCF_000349725.1 in NCBI

Candidate for 16 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-lysine catabolism lysP hi Lysine permease LysP (characterized) 62% 91% 582.8 Histidine permease HisP 57% 533.5
L-histidine catabolism permease med Histidine permease HisP (characterized) 57% 96% 533.5 Lysine permease LysP 62% 582.8
L-arginine catabolism rocE med arginine permease (characterized) 40% 80% 336.7 Lysine permease LysP 62% 582.8
L-alanine catabolism cycA lo General amino-acid permease GAP2 (characterized) 39% 82% 347.1 Lysine permease LysP 62% 582.8
L-threonine catabolism RR42_RS28305 lo D-serine/D-alanine/glycine transporter (characterized, see rationale) 36% 92% 302.8 Lysine permease LysP 62% 582.8
D-alanine catabolism cycA lo L-alanine and D-alanine permease (characterized) 36% 94% 295.8 Lysine permease LysP 62% 582.8
L-isoleucine catabolism Bap2 lo Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) 35% 89% 289.3 Lysine permease LysP 62% 582.8
L-leucine catabolism Bap2 lo Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) 35% 89% 289.3 Lysine permease LysP 62% 582.8
L-phenylalanine catabolism aroP lo Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) 35% 89% 289.3 Lysine permease LysP 62% 582.8
L-proline catabolism proY lo Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) 35% 89% 289.3 Lysine permease LysP 62% 582.8
L-tryptophan catabolism aroP lo Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) 35% 89% 289.3 Lysine permease LysP 62% 582.8
L-valine catabolism Bap2 lo Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) 35% 89% 289.3 Lysine permease LysP 62% 582.8
L-asparagine catabolism AGP1 lo general amino acid permease AGP1 (characterized) 33% 76% 277.7 Lysine permease LysP 62% 582.8
L-tryptophan catabolism TAT lo tryptophan permease (characterized) 33% 82% 270.8 Lysine permease LysP 62% 582.8
L-tyrosine catabolism TAT1 lo valine/tyrosine/tryptophan amino-acid permease (characterized) 32% 76% 256.9 Lysine permease LysP 62% 582.8
L-tyrosine catabolism aroP lo Aromatic amino acid permease, AroP (characterized) 33% 93% 246.5 Lysine permease LysP 62% 582.8

Sequence Analysis Tools

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIALGGSIGTGLFVASGSAISTAGPGGALVAYIGIGLMVYFLMTSLGEMATYLPVTGSFA
TYARRFVDPAMGFAMGWNYWFNWAITLAVDVSTVGLVLKFWFPRVPSWAFSVGALAIIFI
INALSVNSFGETEYWMALIKVVTVIVFLVVGFLTIFGIINGHATYLENFVYRKAPFVGGI
PTILSVFVVAGFSFQGTELIGITAGESENPGESIPKAIKQVFWRIILFYILSIFVIAALI
PYTSPNLLGSDAGDVTISPFTLVFRRAGLAGAAGIMNAVILTSVLSAANSGMYASTRMLF
SLGVSGDAPKIFKRVNTRGIPMPALVGTAAVGLITFATSIFGDRIYNFLVSASGLSGFIA
WVGIAISHYRFRRAFKAQGHDLSELQYHAKWFPFGPILALILCILVIIGQDLGSFASFDW
QAILFSYMSVPLFLILFIYYKIRHKTKLIPLEEVDLTIHEINDEKKDKKG

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory