Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_017867767.1 LACPOB_RS0105155 (S)-acetoin forming diacetyl reductase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_000349725.1:WP_017867767.1 Length = 257 Score = 130 bits (326), Expect = 4e-35 Identities = 84/251 (33%), Positives = 133/251 (52%), Gaps = 6/251 (2%) Query: 16 LISGGAAGIGEVLAAAYLEAGAQVHVCDVSE---SALAVFRDKYPG-TVATRADVSDAAQ 71 +I+GGA GIGE ++ + G V + D+++ S +A +K G +A + DVSD Sbjct: 7 MITGGAQGIGEAISRRLSQDGFAVAIADLNKEKGSQVAADIEKNGGKAIAVKVDVSDRDS 66 Query: 72 IEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHHAVPM 131 + E LG DVLVNNAG+ GPT I+ I+ + +IN+ A+ Sbjct: 67 FFSAVAEVTEKLGSFDVLVNNAGL-GPTTPIETITPEMFDKVYHINVAGDIWGIQAALEQ 125 Query: 132 LKESSHG-HLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPGI 190 ++++HG +++ S AG +G + Y++TK+A+ GL + A +L E +I VNA PGI Sbjct: 126 FRKNNHGGKIINATSQAGVVGNPNLSLYSSTKFAVRGLTQVAARDLAEENITVNAYAPGI 185 Query: 191 VEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARNVTG 250 V+ P M + + G + Q + I+L R+ EDVAA FL P + +TG Sbjct: 186 VKTPMMYDIAHQVGQNAGKDDEWGMQTFAKDIALNRLSEPEDVAAAVSFLAGPDSNYITG 245 Query: 251 QAISVDGNVEY 261 Q I VDG +++ Sbjct: 246 QTIEVDGGMQF 256 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 257 Length adjustment: 24 Effective length of query: 238 Effective length of database: 233 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory