Align Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized)
to candidate WP_017867195.1 LACPOB_RS0102155 amino acid permease
Query= TCDB::Q2VQZ4 (536 letters) >NCBI__GCF_000349725.1:WP_017867195.1 Length = 464 Score = 228 bits (581), Expect = 4e-64 Identities = 130/423 (30%), Positives = 217/423 (51%), Gaps = 12/423 (2%) Query: 33 LKQDLKNRHMQMIAIGGAIGAGLFVGSGGALQKGGPAALLIGYLIIGIMLLCTCLALAEM 92 LK+ ++ RH+ MI++GG IG GLF+ SG + + GP ++ Y + I++ L L E+ Sbjct: 8 LKRRMEARHLLMISLGGVIGTGLFLSSGYTINQAGPIGTILAYTLGAIIVYLVMLCLGEL 67 Query: 93 AVLYPVNGAFFTYIVRFVDPSWGFAMGWQYALAWLTVLPFELIAASITIRFWREDINMAV 152 +V P G+F Y +++ P GF + Y L W L E AA + ++ W D + Sbjct: 68 SVAMPQTGSFHVYADKYIGPGTGFTVAILYWLTWTVALGSEFTAAGLIMKTWFPDTATWI 127 Query: 153 WVSVFLVVLMGIQIFGVRGYGEVEFVLSIIKICACVGFIILGIVINCGGVGDQGYIGVKY 212 W +F+V++ V+ +GE EF+ S IK+ A V FI+LG++ G + +GY Sbjct: 128 WSLLFMVIIFTSNALSVKVFGETEFLFSSIKVIAIVLFIMLGLLAIFGILPIKGYSHAPL 187 Query: 213 WRD---PGAF-TSFKGFCAVFVVAAFSFGGTEMVGLAAAESANPRKSIPMASKQVFWRIA 268 + + G F T FK + F+F GTE++G+ A E+ +P K+IP A R+A Sbjct: 188 FHNLVKDGVFPTGFKSVFTTMLTVNFAFSGTELIGVTAGETKDPEKNIPKAIHTTLLRLA 247 Query: 269 IFYILNLFIVGLILPANDPRLMGASGANTKASPFVLAIQDAGIKVLPSIMNAVITVAVLS 328 IF+I ++ ++ ++P A SPFVL G+ +MN V+ A+LS Sbjct: 248 IFFIGSIVVMASLIPWQQ--------AGVDQSPFVLVFNKIGLPFAGDLMNFVVLTAILS 299 Query: 329 VANSCTFGSTRTIQAMAERNMAPNFFKYIDSKGRPLYCVILQIAFGLLAYIGAAPQGMEI 388 ANS + STR + ++A M P + +S+G P+ +IL + G+LA + + I Sbjct: 300 AANSGLYASTRMLWSLANEGMIPQKYAKTNSRGVPMIALILSMLGGILALLSSVVAASTI 359 Query: 389 FGWLLALTGLGFLFVWGSICLAHIRMRAGMKAQGINLGLIPYKTPFGVAGSYLGLGLNIL 448 + L++++GL + VW +I A I R G + +KTP+ + L L+ L Sbjct: 360 YLVLVSISGLAVVIVWMAIAYAQINFRKQWLKDGHTTAELKFKTPWYPILPWSALILSFL 419 Query: 449 ALI 451 + + Sbjct: 420 SCV 422 Lambda K H 0.327 0.142 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 577 Number of extensions: 31 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 536 Length of database: 464 Length adjustment: 34 Effective length of query: 502 Effective length of database: 430 Effective search space: 215860 Effective search space used: 215860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory