Align L-rhamnose-1-dehydrogenase; EC 1.1.1.173 (characterized)
to candidate WP_017867451.1 LACPOB_RS0103545 acetoin reductase
Query= SwissProt::A3LZU7 (258 letters) >NCBI__GCF_000349725.1:WP_017867451.1 Length = 257 Score = 138 bits (348), Expect = 1e-37 Identities = 91/259 (35%), Positives = 128/259 (49%), Gaps = 15/259 (5%) Query: 8 KVVAITGGVTGIGRAIAIEMARNGAKVVVNHLPSEEQAQLAKELKEEISDGENNVLTIPG 67 KV +TG G+GR IA + ++G V+++ + E + ELK+ +V + G Sbjct: 4 KVAVVTGSAGGLGRGIAERLLKDGFSVMIHDINKEALTKTESELKDL-----GDVASFVG 58 Query: 68 DISLPETGRRIVELAVEKFGEINVFVSNAGVCGFREFLEITPETLFQTVNINLNGAFFAI 127 D+S E +V VEKFG++NVFV+NAGV F++I + L +T IN+ G + Sbjct: 59 DVSKKEDQEALVAATVEKFGQLNVFVNNAGVEAVTPFMDIDDKELERTFKINVFGTVYGT 118 Query: 128 QAAAQQMVKQGKGGSIIGISSISALVGGAHQTHYTPTKAGILSLMQSTACALGKYGIRCN 187 QAAA Q +KQG G II SI+ Y+ +K + + A L I N Sbjct: 119 QAAAAQFIKQGTSGKIINACSIAGHEAYEVLGTYSASKHAVKAFTHVAAKELASKHITVN 178 Query: 188 AILPGTIST----ALNEE------DLKDPEKRKYMEGRIPLGRVGDPKDIAGPAIFLASD 237 A PG T ++EE LK E G I LGR P D+A FLAS+ Sbjct: 179 AYCPGVAKTKMWDRIDEEMVKADPSLKPGEPFAKFSGEIALGRYETPTDVANLVHFLASE 238 Query: 238 MSNYVNGAQLLVDGGLFVN 256 S+Y+ G +LVDGGL N Sbjct: 239 DSDYITGQAILVDGGLVYN 257 Lambda K H 0.317 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 257 Length adjustment: 24 Effective length of query: 234 Effective length of database: 233 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory