GapMind for catabolism of small carbon sources

 

Protein WP_003475284.1 in Gracilibacillus halophilus YIM-C55.5

Annotation: NCBI__GCF_000359605.1:WP_003475284.1

Length: 396 amino acids

Source: GCF_000359605.1 in NCBI

Candidate for 25 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-proline catabolism opuBA med BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 61% 98% 474.2 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
L-proline catabolism proV med glycine betaine/l-proline transport atp-binding protein prov (characterized) 51% 97% 375.9 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
L-histidine catabolism hutV med ABC transporter for L-Histidine, ATPase component (characterized) 58% 95% 314.3 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
L-proline catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 56% 96% 306.6 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
L-tryptophan catabolism ecfA1 med Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 41% 74% 146.4 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 41% 58% 180.6 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 39% 62% 177.2 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 39% 62% 177.2 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 41% 57% 171.8 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 40% 67% 169.9 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 38% 58% 168.3 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 31% 94% 167.5 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 67% 166.8 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 31% 88% 166.8 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 67% 166.8 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 67% 166.8 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 67% 166.8 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 67% 166.8 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 67% 166.8 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 34% 83% 162.2 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 36% 64% 159.8 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 37% 92% 159.1 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 36% 61% 155.6 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 37% 70% 149.4 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 36% 77% 135.6 ABC-type quaternary amine transporter (EC 7.6.2.9) 66% 510.8

Sequence Analysis Tools

View WP_003475284.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MPVIKVENLSKIFGKKTKEATKLLDEGYTKEEVLGETGCTVGVNRANFEVEEGEVFVIMG
LSGSGKSTLVRLLNRLIEPTEGEVEVEGDKLAHMNKEDLRTVRREKMSMVFQKFALFPFR
TVLENTEFGLEIQGISKEERSEKAKNALELVGLGSFINQYPEQLSGGMQQRVGLARALAN
DPEVLLMDEAFSALDPLIRKDMQDELLDLQEKMKKTIIFITHDLDEALRIGDRIALMKDG
SIVQIGSPEEILVNPANDYVERFVEDVDRSKVLTAEHIMKRPETVDIEKHGPRVALERIR
EQGLSSIYVVDRSRNLHGYVTADDVSDARKQEKNDLRDILRTDMPTVSKDAAIQEIFDII
YDAPVPVAVVEDDKLRGIIVRGSVIAALANGNEVNE

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory