Align Lactate utilization protein A (characterized)
to candidate WP_003475110.1 J416_RS14700 (Fe-S)-binding protein
Query= SwissProt::O07020 (238 letters) >NCBI__GCF_000359605.1:WP_003475110.1 Length = 241 Score = 315 bits (806), Expect = 7e-91 Identities = 153/238 (64%), Positives = 178/238 (74%) Query: 1 MKVSLFVTCLVDMFQTNVGKATVELLERLGCEVDFPEGQICCGQPAYNSGYVHDAKKAMK 60 MKVSLF+TCL D+F N GKA VELLE LGC+VDFP Q CCGQPAYNSGY + K+ K Sbjct: 1 MKVSLFITCLGDIFYVNAGKAAVELLEHLGCDVDFPHAQTCCGQPAYNSGYHQETKEIAK 60 Query: 61 RMIETFQDSEYVVSPSGSCTTMFREYPHLFQDDPKWADKAKKLADKTYELTDFIVNVLGV 120 RMIETF+DS+YVV SGSC M +EY +LF+D W +A L +KTYELT FIV+VL V Sbjct: 61 RMIETFEDSQYVVGISGSCVYMLKEYVNLFEDGSNWRQRALALKEKTYELTQFIVHVLQV 120 Query: 121 EDVGATLHTKATLHTSCHMTRLLGVRKEPMKLLSHVKGLQFTELPGKHNCCGFGGTFSVK 180 EDVGA + AT HTSCHMTRLL R+ P LL +VKGL +LP + +CCGFGGTF+VK Sbjct: 121 EDVGAYYNATATYHTSCHMTRLLEEREAPFTLLENVKGLTLVDLPNQQDCCGFGGTFAVK 180 Query: 181 MAQISEQMVDEKVECVEETGAEVLIGADCGCLMNIGGRLGRKDKNVKVMHIAEVLNSR 238 MA ISEQMV EK E + ETGA VL+GAD CLMNIGGRL R + + V HIAE+LNSR Sbjct: 181 MATISEQMVQEKAENISETGANVLLGADASCLMNIGGRLTRNQEPIDVKHIAEILNSR 238 Lambda K H 0.321 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 241 Length adjustment: 23 Effective length of query: 215 Effective length of database: 218 Effective search space: 46870 Effective search space used: 46870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory