Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate WP_003465338.1 J416_RS04015 aldo/keto reductase
Query= BRENDA::Q8TZM9 (278 letters) >NCBI__GCF_000359605.1:WP_003465338.1 Length = 279 Score = 135 bits (340), Expect = 1e-36 Identities = 89/238 (37%), Positives = 138/238 (57%), Gaps = 19/238 (7%) Query: 40 KESIEAIRYGLELGMNLIDTAEFYGAGHAEEIVGEAIKE--FEREDIFIVSKVWPTHFGY 97 +E ++++ LE G IDTA Y E+ VGEAIKE RE++F+ SK+W + GY Sbjct: 31 EEVKNSVKWALEHGYKHIDTAAAY---KNEQGVGEAIKESGIPREELFVTSKLWNGNQGY 87 Query: 98 EEAKKAARASAKRLGT-YIDLYLLHWPVDDFKKIEETLHALEDLVDEGVIRYIGVSNFNL 156 +E A + ++LG Y+DLYL+HWPV + K +E+ A+E L +G IR IGVSNF Sbjct: 88 DETIAAFETTLQQLGMDYLDLYLIHWPVPEQNKYKESWKAMEKLYHDGKIRAIGVSNFKE 147 Query: 157 ELLQRSQEVMRKYEIV--ANQVKYSVKDRWPETT--GLLDYMKREGIALMAYTPLEKGTL 212 L +++++ ++V NQV+Y P T L DY K+ I L A++PL++G + Sbjct: 148 HHL---DDLLQEADVVPMVNQVEYH-----PHLTQKSLHDYCKKHQIQLEAWSPLKQGEI 199 Query: 213 ARNECLAKIGEKYGKTAAQVALNYLIWEENVVAIPKASNKEHLKENFGAMGWRLSEED 270 L +I E++GK+ AQV L + + E VV IPK+ + + EN + LS+++ Sbjct: 200 LSEPVLKEIAERHGKSPAQVILRWDLQNE-VVTIPKSVKQHRIHENADVFDFELSQQE 256 Lambda K H 0.317 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 279 Length adjustment: 25 Effective length of query: 253 Effective length of database: 254 Effective search space: 64262 Effective search space used: 64262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory