Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate WP_156809555.1 J416_RS08120 ribose ABC transporter permease
Query= TCDB::G4FGN4 (313 letters) >NCBI__GCF_000359605.1:WP_156809555.1 Length = 318 Score = 203 bits (516), Expect = 5e-57 Identities = 112/295 (37%), Positives = 179/295 (60%), Gaps = 5/295 (1%) Query: 12 GIFLILIAIVVFLGVTT---REFLTVENIFTVILNVSFIAIMSFGMTMVIITSGIDLSVG 68 G + ++IA ++ V T FL ++N +++ VS I I++ GMT+V+++ GIDLSVG Sbjct: 19 GEYSVVIAFIIIFIVATIMNDRFLYLDNQINILMQVSTIGIIALGMTVVMLSGGIDLSVG 78 Query: 69 SILGAASVVMGLLMDEKGLSPFLSVVIGLAVGVGFGLANGLLITKARLAPFISTLGMLSV 128 S+L V + M+ G S F+ V+ L+VG G+ NGLL++K ++A FI+TLGM++ Sbjct: 79 SVLAMVGVFSVMAMNASG-SIFVGVLTALSVGALTGVINGLLVSKGKIASFIATLGMMAA 137 Query: 129 GRGLAYVMSGGWPISPFPESFTVHGQGMVGPVPVPVIYMAVIGVIAHIFLKYTVTGRRIY 188 R +A + G +S E FT +G V +P+I + + ++ ++ T GR +Y Sbjct: 138 ARSIALYYADGGSMSGEVEGFTAISNTEIGMVDIPIIIFLALTALVYVLMQKTRFGRYVY 197 Query: 189 AIGGNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLTAWL-GVAQPNAGQGYELDVIA 247 A+G N +A+ L I+ DRI I VYT L A + T+ L ++ ++G YELD IA Sbjct: 198 ALGSNEKAALLSAIRVDRIKIGVYTFCSLLVGVAAIIETSRLNSISSSSSGNLYELDAIA 257 Query: 248 ATVIGGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQVVIGIVIIIAI 302 A +IGGT ++GG+G ++G F G +++GVL N M LL +S Q +V G++IIIA+ Sbjct: 258 AVIIGGTRMTGGKGKVIGTFFGVLLLGVLNNMMNLLNISPHLQGLVKGLIIIIAV 312 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 318 Length adjustment: 27 Effective length of query: 286 Effective length of database: 291 Effective search space: 83226 Effective search space used: 83226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory