Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate WP_003462994.1 J416_RS00905 3-oxoacyl-[acyl-carrier-protein] reductase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >NCBI__GCF_000359605.1:WP_003462994.1 Length = 247 Score = 133 bits (335), Expect = 3e-36 Identities = 91/265 (34%), Positives = 137/265 (51%), Gaps = 31/265 (11%) Query: 7 LKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQS--------SGNYNFWPT 58 L++K+ VTG + GIG AI ++ GA+V + DK Q+ G Sbjct: 2 LQDKVALVTGASRGIGRAIALQMAKNGASVAVNYAGSADKAQAVVDEIEEIGGTAIKIQA 61 Query: 59 DISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNI 118 ++S+ EV V I FGR+D LVNNAG+ LL+ ++E F+ +++ Sbjct: 62 NVSNEKEVKAMVKQTIDTFGRLDVLVNNAGITKDNLLM---------RMSEEDFDDVIDT 112 Query: 119 NQKGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKEL 178 N KGVF+ ++AV RQM+KQ+SG I+NVSS G+ G+ GQ+ Y + KA + T+S ++EL Sbjct: 113 NLKGVFVCTKAVTRQMMKQKSGRIINVSSVVGISGNPGQANYVSAKAGVIGLTKSAAQEL 172 Query: 179 GKHGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLTEV 238 I V VAPG + A T +T +Q + S IPL G +V Sbjct: 173 AAKNILVNAVAPGFI------------ATDMTDELTEDQKEQILS--LIPLKTLGEAEDV 218 Query: 239 ADFVCYLLSERASYMTGVTTNIAGG 263 A+ +L S ++ Y+TG T + GG Sbjct: 219 ANTAVFLASNQSKYITGQTIQVDGG 243 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 247 Length adjustment: 24 Effective length of query: 243 Effective length of database: 223 Effective search space: 54189 Effective search space used: 54189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory