Align sorbitol-6-phosphate dehydrogenase subunit (EC 1.1.1.140) (characterized)
to candidate WP_003465757.1 J416_RS04110 SDR family oxidoreductase
Query= metacyc::MONOMER-13092 (266 letters) >NCBI__GCF_000359605.1:WP_003465757.1 Length = 248 Score = 107 bits (266), Expect = 3e-28 Identities = 91/264 (34%), Positives = 132/264 (50%), Gaps = 37/264 (14%) Query: 12 VIVTGASSGIGKAIVDELLSLKVKVA----NFD-----LTDNGEKHENLLFQKVDVTSRE 62 ++VTGA+ G GKAI L +L VA N+D GE H + ++DVT Sbjct: 9 ILVTGANRGQGKAIAQHLATLGAIVAIGARNYDEAKVVAKKIGEGHA--IPVQLDVTKEL 66 Query: 63 QVEASVAAVVEHFGTVDAVVNNAGINIPRLLVDPKDPHGQYELDDATFEKITMINQKGLY 122 + +++V V+ FG +D +VNNAG + + LD+ ++++ INQ G++ Sbjct: 67 EWKSAVDEVINKFGKLDVLVNNAGALKRKSFTETN-------LDE--YQQLININQLGVF 117 Query: 123 LVSQAVGRLLVAKKKGVIINMASEAGLEGSEGQSAYAGTKAAVYSYTRSWAKELGKYGVR 182 + QAV + ++KG IIN S + SAYA TKA+V + +++ A ELG G+R Sbjct: 118 MGMQAVIPQMEKQQKGSIINNVSISAFAPISQSSAYAATKASVVAMSKAAAIELGPKGIR 177 Query: 183 VVGIAPGIMEATGLRTLAYEEALGYTRGKTVEEIRAGYASTTTTPLGRSGKLSEVADLVA 242 V I PG E A+ T+GK V + PLGR G+ E+A VA Sbjct: 178 VNMIHPG----------GVETAMS-TQGKDVP------TYYDSVPLGRIGQPIEIARAVA 220 Query: 243 YYISDRSSYITGITTNVAGGKTRG 266 + SD SSY TG V GG T G Sbjct: 221 FLASDESSYCTGTEIVVDGGMTLG 244 Lambda K H 0.313 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 248 Length adjustment: 24 Effective length of query: 242 Effective length of database: 224 Effective search space: 54208 Effective search space used: 54208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory