Align sorbitol-6-phosphate dehydrogenase (characterized)
to candidate WP_003466622.1 J416_RS05700 SDR family oxidoreductase
Query= CharProtDB::CH_091826 (259 letters) >NCBI__GCF_000359605.1:WP_003466622.1 Length = 232 Score = 84.3 bits (207), Expect = 2e-21 Identities = 46/126 (36%), Positives = 73/126 (57%), Gaps = 1/126 (0%) Query: 60 VDATDEASVEALARAVDETFGRADLLVYSAGVAKAAPITQFRLTDFDLSLQVNLVGYFLC 119 VD TDE SVE + + + D+L+ SAG+ + + DFD + VNL G +L Sbjct: 55 VDVTDEQSVEMFLSKTRDHYSQIDVLINSAGIGMFDSLLESNTADFDRMIAVNLRGTYLA 114 Query: 120 SREFSKLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITV 179 + F K+M +D KG+II + S +G++ N GY+A+KFG +GL++ L +L G+ V Sbjct: 115 CKHFGKVM-KDQQKGQIINLVSIAGQIALPSNGGYTASKFGVMGLSKVLQAELRSEGVQV 173 Query: 180 HSLMLG 185 S++ G Sbjct: 174 TSVLPG 179 Lambda K H 0.319 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 232 Length adjustment: 24 Effective length of query: 235 Effective length of database: 208 Effective search space: 48880 Effective search space used: 48880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory