Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate WP_003464681.1 J416_RS03330 energy-coupling factor transporter ATPase
Query= uniprot:P40735 (281 letters) >NCBI__GCF_000359605.1:WP_003464681.1 Length = 276 Score = 244 bits (624), Expect = 1e-69 Identities = 123/270 (45%), Positives = 184/270 (68%), Gaps = 2/270 (0%) Query: 7 ISVEDIVFRYRKDAERRALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDI 66 I + FRY ++ E LD VS V E +A++G NGSGKST+A+ + GL+ P++G+I Sbjct: 4 IEFRHVSFRYHEN-EPWVLDDVSFVVQSNESVALIGKNGSGKSTIAKLMIGLLQPQAGEI 62 Query: 67 EVAGIQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDWA 126 + G + EE++W++R ++G+VFQNP+NQFVGTTV DDVAFGLEN VPREEM R++ + Sbjct: 63 FIDGQIVNEETIWDIRSQVGLVFQNPENQFVGTTVYDDVAFGLENLAVPREEMTHRIERS 122 Query: 127 VKQVNMQDFLDQEPHHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLETVR 186 ++QV M + D+EPH LSGGQKQR+A+A V+A P I++LDEATSMLDP G E + + R Sbjct: 123 LQQVGMLAYRDREPHDLSGGQKQRIALASVLAVEPKILLLDEATSMLDPHGTESINQLFR 182 Query: 187 HLKEQGMATVISITHDLNEAAKADRIIVMNGGKKYAEGPPEEIFKLNKELVRIGLDLPFS 246 LK + T +++THD E ADR++V++ GK + P ++F + L GL +PF Sbjct: 183 QLKREQNMTHVTVTHDTEEVMYADRVLVIDQGKIAEDCTPRQLFCRQELLDEYGLRIPFI 242 Query: 247 FQLSQLLRENGLALEENHLTQEGLVKELWT 276 +L+ L + G++L++ + + L+ +LWT Sbjct: 243 VELTNELYKQGISLDD-PMNHKELLDQLWT 271 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 276 Length adjustment: 25 Effective length of query: 256 Effective length of database: 251 Effective search space: 64256 Effective search space used: 64256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory