Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate WP_003475284.1 J416_RS14815 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= uniprot:P40735 (281 letters) >NCBI__GCF_000359605.1:WP_003475284.1 Length = 396 Score = 143 bits (360), Expect = 7e-39 Identities = 85/206 (41%), Positives = 127/206 (61%), Gaps = 6/206 (2%) Query: 29 SLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDIEVAGIQLTEESVWEVR----KK 84 + +V EGE I+G +GSGKSTL R LN LI P G++EV G +L + ++R +K Sbjct: 47 NFEVEEGEVFVIMGLSGSGKSTLVRLLNRLIEPTEGEVEVEGDKLAHMNKEDLRTVRREK 106 Query: 85 IGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDWAVKQVNMQDFLDQEPHHLS 144 + MVFQ F TV ++ FGLE G+ +EE E+ A++ V + F++Q P LS Sbjct: 107 MSMVFQK-FALFPFRTVLENTEFGLEIQGISKEERSEKAKNALELVGLGSFINQYPEQLS 165 Query: 145 GGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLETVRHLKEQGMATVISITHDLN 204 GG +QRV +A +A P+++++DEA S LDP+ R+++ + + L+E+ T+I ITHDL+ Sbjct: 166 GGMQQRVGLARALANDPEVLLMDEAFSALDPLIRKDMQDELLDLQEKMKKTIIFITHDLD 225 Query: 205 EAAK-ADRIIVMNGGKKYAEGPPEEI 229 EA + DRI +M G G PEEI Sbjct: 226 EALRIGDRIALMKDGSIVQIGSPEEI 251 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 396 Length adjustment: 28 Effective length of query: 253 Effective length of database: 368 Effective search space: 93104 Effective search space used: 93104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory