Align 2-aminomuconate deaminase; EC 3.5.99.5 (characterized)
to candidate WP_003465357.1 J416_RS04065 RidA family protein
Query= SwissProt::Q9KWS2 (142 letters) >NCBI__GCF_000359605.1:WP_003465357.1 Length = 125 Score = 67.8 bits (164), Expect = 6e-17 Identities = 37/108 (34%), Positives = 56/108 (51%), Gaps = 9/108 (8%) Query: 19 MGSFPHVKRAGDFLFVSGTSSRRPDNTFVGAEPDDTGRPRPNIELQTREVISNIRDILQS 78 +G + AGDF+++SG + +P+ +I QT +V++N+ IL Sbjct: 14 IGPYSQAIDAGDFVYISGQ---------IPLDPESMQIVEGDIVAQTNQVMANLEAILTE 64 Query: 79 VGADLGDVVEVCSYLVNMNDFAAYNKVYAEFFDATGPARTTVAVHQLP 126 G G VV+ Y+ NM+DFA N+ YA+F PAR TV V +LP Sbjct: 65 AGLTFGHVVKFTIYIANMDDFATINEAYAKFLQEPYPARATVEVSKLP 112 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 57 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 142 Length of database: 125 Length adjustment: 15 Effective length of query: 127 Effective length of database: 110 Effective search space: 13970 Effective search space used: 13970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory