Align CbtC, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_004110887.1 RHSP_RS06530 ABC transporter permease
Query= TCDB::Q97VF6 (290 letters) >NCBI__GCF_000359745.1:WP_004110887.1 Length = 300 Score = 145 bits (366), Expect = 1e-39 Identities = 91/279 (32%), Positives = 147/279 (52%), Gaps = 6/279 (2%) Query: 10 LRLLWDNKKSRVGLIITVFYILIAIFGQIIFPKTYSLPPSPTTIFMPPQLSNFYLIFGTG 69 LR ++ KK+ VG II L+AIF II P + PP + + +FGT Sbjct: 5 LRSIFSQKKALVGFIIVAALCLMAIFAPIIAPGEPGARVGRS--HQPPSVEH---VFGTT 59 Query: 70 PFAESILVQIIQGAKSVIEISFLAGLFATLIGIVVGIIAGYLGGIIDNILMGITDIILTL 129 + Q + GA+S + + F G+ T++G +G+IAGY GG D L T+ +L + Sbjct: 60 KMGRDVYRQFVWGARSSLSVGFATGIAITVLGTAIGLIAGYSGGKTDAALDLATNAVLVI 119 Query: 130 PSLILIIIIVSAFKTSNPIFLSLILSITSWAGLARAVRSQVLVIRNSPAVEVLRVLGLSR 189 P++ L+I++ S T P+ + +I+++TSW AR RSQ + +RN V +++G Sbjct: 120 PNMPLLILLASFAGTVGPMTIMIIIALTSWPWGARMTRSQTMALRNRDFVTAAKMIGEPA 179 Query: 190 KYIIFREVVPTLGSYIAIHYIFNVEAAVYAEVGLYYLGVLPYNPNNWGAMIQQALSYGAA 249 IIF E++P L I I+ + ++ A+ A+ L YLG WG M+ A + A Sbjct: 180 WRIIFVEILPNLTPLIGINLVGSIIYAIVAQTTLEYLGFGDPLKVTWGTMLYNAQNASAI 239 Query: 250 AGGKAIYYLAFPTIVVAGFMSGLILLSYGIDEISNPRIR 288 G A + + P I +A GL L+++ DEI+NP++R Sbjct: 240 MVG-AWWDVGVPAIGIALTGLGLALINFTFDEIANPQLR 277 Lambda K H 0.328 0.146 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 300 Length adjustment: 26 Effective length of query: 264 Effective length of database: 274 Effective search space: 72336 Effective search space used: 72336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory