Align CbtC, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_037155070.1 RHSP_RS28480 ABC transporter permease
Query= TCDB::Q97VF6 (290 letters) >NCBI__GCF_000359745.1:WP_037155070.1 Length = 308 Score = 123 bits (308), Expect = 6e-33 Identities = 83/286 (29%), Positives = 134/286 (46%), Gaps = 12/286 (4%) Query: 4 GKFFEYLRLLWDNKKSRVGLIITVFYILIAIFGQIIFPKTYSLPPSPTTIFMPPQLSNFY 63 G+ + R N+ + VGL+I + +LIA +I P + + PP + Sbjct: 28 GRAYVTWRQFSANRLAVVGLLIIIALVLIAALADVIAPHSPVIGDLTNAYLKPPGTPGYL 87 Query: 64 LIFGTGPFAESILVQIIQGAKSVIEISFLAGLFATLIGIVVGIIAGYLGGIIDNILMGIT 123 L GT IL ++I G++ + I L + + IG+++G+I+GYLGG D ILM IT Sbjct: 88 L--GTDDLGRDILSRLIYGSRWTLYIVVLVAIISAPIGLIIGMISGYLGGWTDTILMRIT 145 Query: 124 DIILTLPSLILIIIIVSAFKT--SNPIFLSLILSITSWAGLARAVRSQVLVIRNSPAVEV 181 DI L P L+L + A N I + ++ITSW AR R++ + +R S + Sbjct: 146 DIFLAFPKLVLALAFAGALGAGIENAI---IAIAITSWPPYARLARAETMTVRRSDYIAA 202 Query: 182 LRVLGLSRKYIIFREVVPTLGSYIAIHYIFNVEAAVYAEVGLYYLGVLPYNP-NNWGAMI 240 ++++G S IIFR V+P S + + ++ + GL +LG+ P WG MI Sbjct: 203 VQLMGASPLRIIFRHVMPLCISSVIVRVTLDMAGVILTAAGLGFLGLGAQPPLPEWGVMI 262 Query: 241 QQALSYGAAAGGKAIYYLAFPTIVVAGFMSGLILLSYGIDEISNPR 286 Y + A P I + G LL G+ + +P+ Sbjct: 263 ASGFKYYL----DQWWVAAMPGIAILIVSLGFNLLGDGLRDALDPK 304 Lambda K H 0.328 0.146 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 308 Length adjustment: 27 Effective length of query: 263 Effective length of database: 281 Effective search space: 73903 Effective search space used: 73903 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory