Align Gluconate 2-dehydrogenase cytochrome c subunit; GA 2-DH cytochrome c subunit; GADH cytochrome c subunit; EC 1.1.99.3 (characterized)
to candidate WP_037153268.1 RHSP_RS19630 cytochrome c
Query= SwissProt::O34215 (441 letters) >NCBI__GCF_000359745.1:WP_037153268.1 Length = 304 Score = 162 bits (409), Expect = 2e-44 Identities = 95/275 (34%), Positives = 149/275 (54%), Gaps = 20/275 (7%) Query: 25 DALVKRGEYLARAGDCVACHSVKGGQPFA-----GGLPMATPIGTIYSTNITPDKTTGIG 79 D +K GE + AG C +CH+ G Q A GGL + +P GT + NI+PD+ G+G Sbjct: 42 DPDLKTGEMVFWAGGCTSCHAAPGAQGDAKLMLSGGLGLKSPFGTFHVPNISPDEKAGLG 101 Query: 80 DYSYDDFQKAVRHGVAKNGDTLYPAMPYPSYAVVSDEDMKALYAYFMHGVAPVAQANKDS 139 ++ DF A++ GV +NG+ LYP+ PY SY+ +SD+D+ L+ F+ + + Sbjct: 102 SWTLADFGNAMKRGVGRNGEHLYPSFPYGSYSRMSDKDINDLWG-FLKTLPKSSNVAPPH 160 Query: 140 DIPWPLSMRWPLAIWRGVFAPDVKAFQP---AAQEDPVLARGRYLVEGLGHCGACHTPRS 196 ++P+P ++R L W+ ++ D QP A+ D + RG+YLVEG GHCG CHTPR Sbjct: 161 ELPFPFNIRLALGAWKFLYLND----QPRVVLAKADDKIKRGQYLVEGPGHCGECHTPRD 216 Query: 197 ITMQEKALSNDGAHDYLSGSSAPIDGWTASNLRGDNRDGLGRWSEDDLRQFLRYGRNDHT 256 +L + +L+G+ P ++R ++ +G WS D+ +L G + Sbjct: 217 ------SLGGFLSGQWLAGAPNPEGKGQIPDIRPGSK-AIGSWSAGDIANYLETGFTPNY 269 Query: 257 AAFGGMTDVVEHSLQHLSDDDITAIARYLKSLGAK 291 + GG V+ ++ HL D AIA YLK+L AK Sbjct: 270 DSAGGSMAEVQQNIAHLPATDREAIAAYLKALPAK 304 Lambda K H 0.317 0.133 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 511 Number of extensions: 39 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 304 Length adjustment: 30 Effective length of query: 411 Effective length of database: 274 Effective search space: 112614 Effective search space used: 112614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory