Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate WP_004122049.1 RHSP_RS20465 carbohydrate ABC transporter permease
Query= uniprot:A3DE71 (289 letters) >NCBI__GCF_000359745.1:WP_004122049.1 Length = 291 Score = 162 bits (411), Expect = 6e-45 Identities = 97/296 (32%), Positives = 170/296 (57%), Gaps = 16/296 (5%) Query: 1 MAKIGYFESMKRKKKIKDTIANIILAILVVLTLGPIVFMVLTSL---MDHNAIARGKWIA 57 +AK + S R+ I+ + A + +++ +V+TL PI ++ S +D A+ +W+ Sbjct: 5 LAKTIHARSRTREMLIRLS-AYLTISVALVVTLFPIYWIASNSFKFDIDIFAVPP-EWLP 62 Query: 58 --PTRFSNYVEVFQKLPFGIYFRNSLIVCSIVMVVALVIATLAGYSLAKYKFPGSGF--F 113 PT +Y E F + PF Y NS +V VV++ T+AGY+LA++ +P Sbjct: 63 RNPT-LKHYDEAFIQRPFLRYALNSFLVAVGTTVVSVTFGTMAGYALARFSYPWQWRKQI 121 Query: 114 GILILATQLLPGMMFLLPLYLDFVKIKQATGIQLINSIPGLVIVYSAFFVPFSIWIIRGF 173 IL+T+++P ++ ++PLYL F ++N+ L++ Y+AF +PF+ W+++ + Sbjct: 122 SFWILSTRMMPPIVSIIPLYLFF------NYFDMLNTKSALIVAYTAFNLPFATWMMKSY 175 Query: 174 FASIPGELEEAARIDGCNKFTAFLRVMLPLAVPGIVATAIYIFLTAWDELIFAWVLLKDT 233 F +P ELEEAA +DG ++ AFL V LPLA PG+ ATAI+ + +W+E + + ++ Sbjct: 176 FQDLPVELEEAAIVDGDTRWGAFLHVALPLARPGLAATAIFCLIISWNEFLLSLIITLTE 235 Query: 234 KVTTIPAGIRGFIAYTTARYDLLMAAGTIVTIPVLIMFFTMQKKFISGMTAGAVKG 289 + T+P GI G + + + AAG + +P++I F +QK + G++ GAVKG Sbjct: 236 QSQTLPIGIAGRVTQYNTYWGEISAAGFMACVPIVIFAFIVQKHLVRGLSLGAVKG 291 Lambda K H 0.332 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 291 Length adjustment: 26 Effective length of query: 263 Effective length of database: 265 Effective search space: 69695 Effective search space used: 69695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory