Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate WP_004124101.1 RHSP_RS23330 hypothetical protein
Query= uniprot:A0A0C4Y7K0 (337 letters) >NCBI__GCF_000359745.1:WP_004124101.1 Length = 334 Score = 233 bits (595), Expect = 4e-66 Identities = 140/313 (44%), Positives = 189/313 (60%), Gaps = 10/313 (3%) Query: 30 LRALGMLPVLVLLCIGFSVLTENFAGWQNLSIIAQQASINMVLAAGMTFVILTGGIDLSV 89 ++ G+ +LL I S E F N+S + Q SIN VLA GMTFVILT GIDLSV Sbjct: 22 IQEYGIFLAFLLLAIVLSFSNEYFLTAGNISNVLLQTSINGVLAIGMTFVILTRGIDLSV 81 Query: 90 GSILSISAVV-AMLVSLMPQLGMLSVP----AALLCGLLFGIVNGALVAFM----KLPPF 140 GS+++++ +V A + G++ P AL GLL G+ GA+V + +P F Sbjct: 82 GSVVALTGIVSASFATTSATAGIVGAPYPPYVALAVGLLVGVACGAVVGLIVSRFAVPAF 141 Query: 141 IVTLGTLTAVRGLARLVGNDSTIYNPDIGFAFIGNGEVLGVPWLVIIAFAVVAVSWFVLR 200 + TLG L+A RG+ + G + F +IG G VL +P VI+ V V+W+VL Sbjct: 142 VATLGMLSAARGMTLIYGGGKPVPALTPDFRWIGTGSVLSIPMPVILLAIVFIVAWWVLN 201 Query: 201 RTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAANGLQLG 260 RT G IYAVGGN AA SGI V + VY +SG L+GL G++ +AR +A Q G Sbjct: 202 RTRFGRYIYAVGGNPHAATTSGIDVSKLRFLVYVISGGLSGLAGMILAARTGSALP-QAG 260 Query: 261 QSYELDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGVSDIWQYIIKGLVI 320 +YELDAIAAV++GGTS GG G I GTL+GALII V++NGL L+G+ +Q ++KG +I Sbjct: 261 IAYELDAIAAVVIGGTSLSGGVGRITGTLIGALIIGVMNNGLDLMGIQSYYQQVLKGTLI 320 Query: 321 IGAVALDSYRRKG 333 +GAV LD R G Sbjct: 321 VGAVMLDQKRNLG 333 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 334 Length adjustment: 28 Effective length of query: 309 Effective length of database: 306 Effective search space: 94554 Effective search space used: 94554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory