Align ABC transporter for L-Fucose, permease component 1 (characterized)
to candidate WP_037151767.1 RHSP_RS13680 sugar ABC transporter permease
Query= reanno::Smeli:SM_b21104 (298 letters) >NCBI__GCF_000359745.1:WP_037151767.1 Length = 297 Score = 475 bits (1223), Expect = e-139 Identities = 231/294 (78%), Positives = 263/294 (89%) Query: 5 KLSAPTLLLLPAFIVLAVFIVLPLIFSLYSSFTPFRLTKPDSLWVFIGFRNYVNVLTNAE 64 K+S P LLLLPA IVL ++ PL+ S YSSFTPFRLTKP +L+ FIG RNY+ +LT+ Sbjct: 4 KISPPVLLLLPAIIVLVAVVLFPLLLSFYSSFTPFRLTKPATLFTFIGLRNYMRILTDPV 63 Query: 65 FWVAFGRTVLLLTVALNAEMFLGLGLALLVNKATYGQRALRTAMMFPMMFSPVLVGFQFK 124 F AF RTV+LLT+ALN EM LGLGLA+LVNKAT+G+R LRT MMFPMMFSPVLVGFQFK Sbjct: 64 FLAAFVRTVVLLTIALNLEMLLGLGLAVLVNKATHGKRVLRTLMMFPMMFSPVLVGFQFK 123 Query: 125 FLFNDNIGFVNNALQSLGLTDRAIPWLIDGNLALFSIIVAEVWSSTAVFAILILAGLLAM 184 F+FNDN+G +NNALQSLG+T+ AIPWLIDGNLAL SI++AEVWSST+VFAILILAGLLAM Sbjct: 124 FMFNDNVGIINNALQSLGITNDAIPWLIDGNLALLSIVIAEVWSSTSVFAILILAGLLAM 183 Query: 185 PKDPVEAAHVDGCTPWQTFRYVTWPYLMPFAFIAMTIRSLDVARAYDIVKIMTDGGPAKR 244 P++PVEAA VDGCT WQTFRYVTWP+LMPFAFIAMTIRSLDVARAYDIVKIMTDGGPA+R Sbjct: 184 PQEPVEAAKVDGCTSWQTFRYVTWPFLMPFAFIAMTIRSLDVARAYDIVKIMTDGGPARR 243 Query: 245 TELLWTLIGRTAYGDARMGMANAMAYVAILLSIFFTVYFFRKLAAARQQIGAEW 298 TEL+WTL+GRTAY DA+MG+ANAMAYV+I+LSI FTVYFFRKLA AR QIGAEW Sbjct: 244 TELIWTLVGRTAYADAQMGLANAMAYVSIILSIAFTVYFFRKLALARTQIGAEW 297 Lambda K H 0.331 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 297 Length adjustment: 26 Effective length of query: 272 Effective length of database: 271 Effective search space: 73712 Effective search space used: 73712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory