Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate WP_004124101.1 RHSP_RS23330 hypothetical protein
Query= SwissProt::P37772 (331 letters) >NCBI__GCF_000359745.1:WP_004124101.1 Length = 334 Score = 169 bits (427), Expect = 1e-46 Identities = 102/282 (36%), Positives = 158/282 (56%), Gaps = 15/282 (5%) Query: 29 FASTRVICNILTDNAFLGIIAVGMTFVILSGGIDLSVGSVIAFTGVFLAK------VIGD 82 F + I N+L + G++A+GMTFVIL+ GIDLSVGSV+A TG+ A G Sbjct: 45 FLTAGNISNVLLQTSINGVLAIGMTFVILTRGIDLSVGSVVALTGIVSASFATTSATAGI 104 Query: 83 FGLS--PLLAFPLVLVMGCAFGAFMGLLIDALKIPAFIITLAGMFFLRGVSYLVSEESIP 140 G P +A + L++G A GA +GL++ +PAF+ TL + RG++ + Sbjct: 105 VGAPYPPYVALAVGLLVGVACGAVVGLIVSRFAVPAFVATLGMLSAARGMTLIYGG---- 160 Query: 141 INHPIYDTLSSLAWKIPGGGRLSAMGLLMLAVV-VIGIFLAHRTRFGNQVYAIGGNATSA 199 P+ W G M +++LA+V ++ ++ +RTRFG +YA+GGN +A Sbjct: 161 -GKPVPALTPDFRWIGTGSVLSIPMPVILLAIVFIVAWWVLNRTRFGRYIYAVGGNPHAA 219 Query: 200 NLMGISTRSTTIRIYMLSTGLATLAGIVFSIYTQAGYALAGVGVELDAIASVVIGGTLLS 259 GI +Y++S GL+ LAG++ + T + AG+ ELDAIA+VVIGGT LS Sbjct: 220 TTSGIDVSKLRFLVYVISGGLSGLAGMILAARTGSALPQAGIAYELDAIAAVVIGGTSLS 279 Query: 260 GGVGTVLGTLFGVAIQGLIQTYINFDGTLSSWWTKIAIGILL 301 GGVG + GTL G I G++ ++ G + S++ ++ G L+ Sbjct: 280 GGVGRITGTLIGALIIGVMNNGLDLMG-IQSYYQQVLKGTLI 320 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 334 Length adjustment: 28 Effective length of query: 303 Effective length of database: 306 Effective search space: 92718 Effective search space used: 92718 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory