Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate WP_037152422.1 RHSP_RS16220 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b21219 (281 letters) >NCBI__GCF_000359745.1:WP_037152422.1 Length = 287 Score = 156 bits (395), Expect = 4e-43 Identities = 96/273 (35%), Positives = 150/273 (54%), Gaps = 10/273 (3%) Query: 13 HASALLLAVVILAPVAWLLIMSISPAADLSAKPLAWWPSD-IDLSRYRTLLSAVENSAGA 71 H +++ + AP A L+ S + S PL WP+ YR+L N GA Sbjct: 20 HGIGVVIVIFFFAPFAIALLSSFRHGTEASLPPLPPWPTTGFSFDAYRSL-----NGFGA 74 Query: 72 AFIASLLNSIKVAGMATLAAVVVAVPAAWAVSRT--PAVAWSLYAVIATYMLPPVALAVP 129 + LNS+ V+ L V+V++ A + SR P +IAT M+P ++ P Sbjct: 75 GVLQHTLNSLFVSVATVLLTVIVSLLAGYGFSRYRFPFKGALFILIIATLMIPFQSILTP 134 Query: 130 LYMGLAYFGLLNSVFGLALVYLTILAPFTTWLLKSGFDSIPREIESAAMIDGARLDQILR 189 L++ LA GL NS+ GL LVY+T+ PF+ +++++ FD++P+EIE AA IDGAR ++L Sbjct: 135 LFIILARLGLNNSLIGLTLVYVTLQLPFSVFMMRNAFDAVPKEIEEAARIDGARDLKLLF 194 Query: 190 ILTLPLAAPVMATSALFAFLLAWDEFFYALLFTSDQRAKTLTVAIADLAGGRVS--DYGL 247 + PL P +AT A+FAFL AW+EF AL+ S TL V + + GR+ ++G Sbjct: 195 RVLFPLVLPGVATVAIFAFLNAWNEFLAALVLLSSNEKFTLPVLMIAVRTGRLGAVNWGA 254 Query: 248 IATAGVLAALPPVLIGLIMQRALISGLTSGGVK 280 + + +P V++ L++QR + GL +G VK Sbjct: 255 VQAGIAVMTIPCVIVFLLLQRYYMRGLMAGAVK 287 Lambda K H 0.325 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 287 Length adjustment: 26 Effective length of query: 255 Effective length of database: 261 Effective search space: 66555 Effective search space used: 66555 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory