Align ABC transporter for Lactose, permease component 1 (characterized)
to candidate WP_037152420.1 RHSP_RS16215 sugar ABC transporter permease
Query= reanno::Smeli:SM_b21653 (298 letters) >NCBI__GCF_000359745.1:WP_037152420.1 Length = 305 Score = 155 bits (391), Expect = 1e-42 Identities = 95/282 (33%), Positives = 152/282 (53%), Gaps = 6/282 (2%) Query: 10 RYYDVNGWLFVAPALGLITLFMVYPIAWSLWMSFQSGRGM-TLKFAGFANIVRLWNDPVF 68 R+ +G+L++APA+ L+ +F V P+ +++WMSF + + ++ GF N +R+++D F Sbjct: 17 RHAGWHGFLYIAPAMALVIVFFVLPVVFTVWMSFHNWPLLGNPRWIGFGNYIRMFSDMRF 76 Query: 69 IKALTNTMTYFVVQVPIMILLALILASLLNNPRLVGRGVFRTAIFLPCVSSLVAYSVLFK 128 + AL T Y VV + +A LA + + G++RT IFLP V L S+L+ Sbjct: 77 MAALRFTAYYTVVVTIAIFAVAFPLAFFVEKHKPFV-GLYRTVIFLPVVIGLATASLLWV 135 Query: 129 GMFATD-GIVNSTLQAIGLAASPIPWLTHPFWAKVLVILAITWRWTGYNMIFYLAALQNI 187 + D G A+GL L A +I+ + W+ G+ MI L LQ I Sbjct: 136 WLANVDSGFFAPIALALGLVDKRPNLLADFDMAFATIIVMVVWKIAGFTMIILLTGLQAI 195 Query: 188 DKSIYEVARIDGVPAWARLTHLTIPLLKPVILFTTVISTIGTLQLFDEVYNLTEGKGGPS 247 + E ARIDG W R HLT+PL++ I +IS G++ FD+ Y +T GGP Sbjct: 196 PSELTEAARIDGARRWQRFRHLTLPLMRRTIALALIISITGSVLAFDQFYIMT--SGGPQ 253 Query: 248 NATLTLSLYIYNLTFRFMPNLGYAATVSYVIVVLVALLAFVQ 289 N +++ YI+N +F NLGY A +S ++V++ L++ VQ Sbjct: 254 NRMISVVYYIFNQSFVSF-NLGYGAALSIALLVILVLISVVQ 294 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 305 Length adjustment: 27 Effective length of query: 271 Effective length of database: 278 Effective search space: 75338 Effective search space used: 75338 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory