Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_004124101.1 RHSP_RS23330 hypothetical protein
Query= uniprot:D8IZC8 (344 letters) >NCBI__GCF_000359745.1:WP_004124101.1 Length = 334 Score = 229 bits (585), Expect = 6e-65 Identities = 138/306 (45%), Positives = 186/306 (60%), Gaps = 12/306 (3%) Query: 41 LYLLFYGLTLYLSGDGTSNFASAENTMNILRQVAINLVLAAGMTFVILTAGIDLSVGSVL 100 ++L F L + LS F +A N N+L Q +IN VLA GMTFVILT GIDLSVGSV+ Sbjct: 27 IFLAFLLLAIVLSFSN-EYFLTAGNISNVLLQTSINGVLAIGMTFVILTRGIDLSVGSVV 85 Query: 101 AVSAVLGMQVSLGAA----------PGWAIPMFIFSGLVMGMVNGAMVALLNINAFVVTL 150 A++ ++ + +A P A+ + + G+ G V G +V+ + AFV TL Sbjct: 86 ALTGIVSASFATTSATAGIVGAPYPPYVALAVGLLVGVACGAVVGLIVSRFAVPAFVATL 145 Query: 151 GTMTAFRGAAYLLADGTTVLNNDIPSFEWIGNGDFLHVPWLIWVAVAVVLLSWVILRKTV 210 G ++A RG + G V P F WIG G L +P + + V +++W +L +T Sbjct: 146 GMLSAARGMTLIYGGGKPVPALT-PDFRWIGTGSVLSIPMPVILLAIVFIVAWWVLNRTR 204 Query: 211 LGMHIYAIGGNLQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSASRLYGANGNWGSGYE 270 G +IYA+GGN AA +GI V + VY ISG SGLAG + A+R A G YE Sbjct: 205 FGRYIYAVGGNPHAATTSGIDVSKLRFLVYVISGGLSGLAGMILAARTGSALPQAGIAYE 264 Query: 271 LDAIAAVVLGGTSLMGGVGSIWGTVVGALIIGVMNNGLTILGLSSFWQYVAKGAVIVLAV 330 LDAIAAVV+GGTSL GGVG I GT++GALIIGVMNNGL ++G+ S++Q V KG +IV AV Sbjct: 265 LDAIAAVVIGGTSLSGGVGRITGTLIGALIIGVMNNGLDLMGIQSYYQQVLKGTLIVGAV 324 Query: 331 ILDKWR 336 +LD+ R Sbjct: 325 MLDQKR 330 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 334 Length adjustment: 28 Effective length of query: 316 Effective length of database: 306 Effective search space: 96696 Effective search space used: 96696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory