Align Glucose transport system permease protein aka TT_C0327, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized)
to candidate WP_004119217.1 RHSP_RS16130 sugar ABC transporter permease
Query= TCDB::Q72KX3 (369 letters) >NCBI__GCF_000359745.1:WP_004119217.1 Length = 299 Score = 113 bits (282), Expect = 8e-30 Identities = 99/370 (26%), Positives = 163/370 (44%), Gaps = 85/370 (22%) Query: 4 RILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELF 63 R+ A ++L P++L +F + + +S W L P+ FVGL NY+ +F Sbjct: 11 RVQAAILLAPAMLIYAIFALYPMLNVVVLSFQKWN-------GLDPQRPFVGLANYQYIF 63 Query: 64 TGFVDVRFRQSVVNLIFFTLFFMAGSLGLGLLLALAVDKAPRGEGFFRTVFLFPMALSFV 123 T D F + N + +T+ + +GLLLAL++++ FR +F P+ ++ + Sbjct: 64 TQ--DPVFWVAFRNTVIWTIMCVIFPPMVGLLLALSLNQKLFARNTFRAIFYLPVIIAPI 121 Query: 124 VTGTIWRWLLQPQGGV-NVLPTLFGLPPLSFPWLATREQVLVFDWNRLPFYTALVVGLVL 182 T+W+W+ P G+ + T G WL ++ + Sbjct: 122 AVATMWKWMYDPFFGLFTEILTSMGFQGWIQDWLGDKD--------------------IA 161 Query: 183 LYVAYTAYREGERRRALWGLASAGVLLLWAFAFGQGLRLLPYPEVHGFSLALVGVILAAV 242 LY + AY LW + GFS Sbjct: 162 LYSVFVAY--------LW-------------------------QSVGFS----------- 177 Query: 243 WQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHI- 301 M L+LAGL+ + ++EAAR+DGA W +FR V P L TL+ ++VL I Sbjct: 178 -------MVLFLAGLQNVSQTLVEAARIDGAGRWNIFRYVTLPALR-TTLTIVLVLSVIS 229 Query: 302 ALKIFDLVFAMAGLDYA-PTDVPAIYMYLLAFRGNQFAKGAAIGILLLLLVAVVVVPYLA 360 +LK FD+V+ + G A T + A++ + A + F +GAAI ++LL + +VV+PYL Sbjct: 230 SLKAFDIVYGLTGGGPAQSTQMLALWAFTQAMQIFDFGRGAAISVVLLFITIIVVIPYLR 289 Query: 361 -TQLRKEVRR 369 TQ +E + Sbjct: 290 WTQKHEEAEQ 299 Lambda K H 0.331 0.146 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 369 Length of database: 299 Length adjustment: 28 Effective length of query: 341 Effective length of database: 271 Effective search space: 92411 Effective search space used: 92411 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory