Align Inositol transport system ATP-binding protein (characterized)
to candidate WP_004124215.1 RHSP_RS23465 sugar ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >NCBI__GCF_000359745.1:WP_004124215.1 Length = 262 Score = 342 bits (877), Expect = 5e-99 Identities = 175/262 (66%), Positives = 210/262 (80%), Gaps = 1/262 (0%) Query: 1 MSMSQ-PLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKP 59 MS SQ P++ ++ + KHFGS+IAL GVS+ V GE CLLGDNGAGKST I T+SGV KP Sbjct: 1 MSTSQTPIVEVKNLVKHFGSIIALNGVSLSVNAGEVLCLLGDNGAGKSTLINTLSGVFKP 60 Query: 60 TKGDILFEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLF 119 T G+ L EGQP F PRDA+ AGIATV+Q LAMIPLMSV+RNFFMG EP++ GP K Sbjct: 61 TSGEFLVEGQPRTFNGPRDALDAGIATVYQDLAMIPLMSVTRNFFMGREPLKGFGPFKHM 120 Query: 120 DHDYANRITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSAL 179 D D+A+ +T +EMRK+GI++R PDQAVGTLSGGERQ VAIARAV+FGAKVLILDEPTSAL Sbjct: 121 DMDFASNVTRDEMRKIGIDVREPDQAVGTLSGGERQCVAIARAVYFGAKVLILDEPTSAL 180 Query: 180 GVRQTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEE 239 GV QT+ VL ID+VR +G+ V+FITHNVRHA AVG+RFT LNRGKTLGT + +I + Sbjct: 181 GVAQTSMVLKYIDQVRSKGLGVIFITHNVRHAYAVGNRFTALNRGKTLGTFAKSEIDLDG 240 Query: 240 LQDMMAGGQELATLEGSLGGTV 261 LQ++MAGG+EL +L LGGTV Sbjct: 241 LQNLMAGGKELQSLSEELGGTV 262 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 262 Length adjustment: 25 Effective length of query: 236 Effective length of database: 237 Effective search space: 55932 Effective search space used: 55932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory