Align RhaQ (characterized, see rationale)
to candidate WP_004124101.1 RHSP_RS23330 hypothetical protein
Query= uniprot:Q7BSH2 (337 letters) >NCBI__GCF_000359745.1:WP_004124101.1 Length = 334 Score = 155 bits (393), Expect = 1e-42 Identities = 96/316 (30%), Positives = 168/316 (53%), Gaps = 12/316 (3%) Query: 18 GTPLRRIAASWEVLLFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEKAMIAFAMALLV 77 G+ RR+ E +F +L+ + S ++ YFL A N+S+ + ++A M ++ Sbjct: 14 GSDRRRLIIQ-EYGIFLAFLLLAIVLSFSNEYFLTAGNISNVLLQTSINGVLAIGMTFVI 72 Query: 78 ISGEIDLSVAAIIALA-------STAMGAAVQIGIGTPGLVLIGIG--TGLACGVFNGVL 128 ++ IDLSV +++AL +T A +G P V + +G G+ACG G++ Sbjct: 73 LTRGIDLSVGSVVALTGIVSASFATTSATAGIVGAPYPPYVALAVGLLVGVACGAVVGLI 132 Query: 129 VSVLKLPSIVVTIGTMSLFRGISYIVLGDQAYGKYPADFAYFGQGYVVWVFSFEFVLFIV 188 VS +P+ V T+G +S RG++ I G + DF + G G V+ + +L IV Sbjct: 133 VSRFAVPAFVATLGMLSAARGMTLIYGGGKPVPALTPDFRWIGTGSVLSIPMPVILLAIV 192 Query: 189 LAVLFAILLHATNFGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCLTSR 248 V + +L + T FGR +YA+G N AA SGI V +++ ++++++G +SG+A + L +R Sbjct: 193 FIVAWWVL-NRTRFGRYIYAVGGNPHAATTSGIDVSKLRFLVYVISGGLSGLAGMILAAR 251 Query: 249 LGSTRPSIAQGWELEVVTMVVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNLPGI 308 GS P +EL+ + VV+GG S+ GG G +I A ++G++ GL L+ + Sbjct: 252 TGSALPQAGIAYELDAIAAVVIGGTSLSGGVGRITGT-LIGALIIGVMNNGLDLMGIQSY 310 Query: 309 VMSIFIGLLIIVTIAI 324 + G LI+ + + Sbjct: 311 YQQVLKGTLIVGAVML 326 Lambda K H 0.330 0.145 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 334 Length adjustment: 28 Effective length of query: 309 Effective length of database: 306 Effective search space: 94554 Effective search space used: 94554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory