Align Ribose import permease protein RbsC (characterized)
to candidate WP_004124101.1 RHSP_RS23330 hypothetical protein
Query= SwissProt::P0AGI1 (321 letters) >NCBI__GCF_000359745.1:WP_004124101.1 Length = 334 Score = 295 bits (756), Expect = 8e-85 Identities = 157/313 (50%), Positives = 213/313 (68%), Gaps = 13/313 (4%) Query: 17 LMEQKSLIALLVLIAIVSTLSPNFFTINNLFNILQQTSVNAIMAVGMTLVILTSGIDLSV 76 + E +A L+L ++S + F T N+ N+L QTS+N ++A+GMT VILT GIDLSV Sbjct: 22 IQEYGIFLAFLLLAIVLSFSNEYFLTAGNISNVLLQTSINGVLAIGMTFVILTRGIDLSV 81 Query: 77 GSLLALTGAVAAS---------IVGIEVNALVAVAAALALGAAIGAVTGVIVAKGRVQAF 127 GS++ALTG V+AS IVG VA+A L +G A GAV G+IV++ V AF Sbjct: 82 GSVVALTGIVSASFATTSATAGIVGAPYPPYVALAVGLLVGVACGAVVGLIVSRFAVPAF 141 Query: 128 IATLVMMLLLRGVTMVYTNGSPVNTGFTENADLFGWFGIGRPLGVPTPVWIMGIVFLAAW 187 +ATL M+ RG+T++Y G PV + F W G G L +P PV ++ IVF+ AW Sbjct: 142 VATLGMLSAARGMTLIYGGGKPVPALTPD----FRWIGTGSVLSIPMPVILLAIVFIVAW 197 Query: 188 YMLHHTRLGRYIYALGGNEAATRLSGINVNKIKIIVYSLCGLLASLAGIIEVARLSSAQP 247 ++L+ TR GRYIYA+GGN A SGI+V+K++ +VY + G L+ LAG+I AR SA P Sbjct: 198 WVLNRTRFGRYIYAVGGNPHAATTSGIDVSKLRFLVYVISGGLSGLAGMILAARTGSALP 257 Query: 248 TAGTGYELDAIAAVVLGGTSLAGGKGRIVGTLIGALILGFLNNGLNLLGVSSYYQMIVKA 307 AG YELDAIAAVV+GGTSL+GG GRI GTLIGALI+G +NNGL+L+G+ SYYQ ++K Sbjct: 258 QAGIAYELDAIAAVVIGGTSLSGGVGRITGTLIGALIIGVMNNGLDLMGIQSYYQQVLKG 317 Query: 308 VVILLAVLVDNKK 320 +I+ AV++D K+ Sbjct: 318 TLIVGAVMLDQKR 330 Lambda K H 0.324 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 334 Length adjustment: 28 Effective length of query: 293 Effective length of database: 306 Effective search space: 89658 Effective search space used: 89658 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory