Align N-acetylglucosamine kinase (EC 2.7.1.59) (characterized)
to candidate WP_004119317.1 RHSP_RS16295 ROK family transcriptional regulator
Query= metacyc::MONOMER-19002 (326 letters) >NCBI__GCF_000359745.1:WP_004119317.1 Length = 381 Score = 125 bits (314), Expect = 2e-33 Identities = 97/299 (32%), Positives = 147/299 (49%), Gaps = 26/299 (8%) Query: 24 IVDARGTIIASGAVKTQVYPTVEEYADEVCKNLLPLIIANGGV--DKIKGIGIGAPNG-N 80 + D T IAS V T E E +P ++A+ G + G+G+ P + Sbjct: 95 LTDLATTPIAS--FDMPVPDTRPETMVEAIATAIPKLLADAGRTGSPVMGVGVSIPGEVD 152 Query: 81 YYTGTIEFAPNLPWKGVLPLASMFEERLGIPTALTNDANAAAVGEMTYGAARGMKDFIMI 140 G +P W+ L + E++ IP + +D +A V + +GA R +F I Sbjct: 153 AVKGICIQSPRFGWRN-LAFPELLREQVHIPVWIDDDISAFTVAQRLFGAGRNYSNFATI 211 Query: 141 TLGTGVGSGIVINGQVVYGHDGFAGELGHVIVRRDGRICGCGRKGCLETYCSATGVARTA 200 +GTGVGS +V++G++ +G G AG+LGH+I GR+C CGR+GCL+ A TA Sbjct: 212 AVGTGVGSSLVMDGEIYHGSHGLAGKLGHIITVPGGRLCECGRRGCLQ--------AHTA 263 Query: 201 REFLAARTDASLLRNIPAESIVSKDVYDAAVQ-GDKLAQEIFEFTGNILGEALADAIAFS 259 AA D LR + ++D Y AAV+ GD A EI G ++G LAD + Sbjct: 264 E---AAMIDEWGLRR---GAKATRDEYAAAVETGDADALEIMAQAGELIGRHLADLVNLF 317 Query: 260 SPEAIILFGGLAKSGDYIMKPIMKAMENNLLNIYKGKAKLLVSELKDSDAAVLGASALA 318 PE +I G + GD I++PI ++M ++ +LL + S A GA+ALA Sbjct: 318 DPEVLIAGGEAMQFGDAILEPIRRSMAK---YVFLNTPELLPDWVPGSWAR--GAAALA 371 Lambda K H 0.318 0.138 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 381 Length adjustment: 29 Effective length of query: 297 Effective length of database: 352 Effective search space: 104544 Effective search space used: 104544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory