Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_004112627.1 RHSP_RS07985 ABC transporter ATP-binding protein
Query= uniprot:A0A165KQ08 (355 letters) >NCBI__GCF_000359745.1:WP_004112627.1 Length = 371 Score = 369 bits (948), Expect = e-107 Identities = 200/371 (53%), Positives = 250/371 (67%), Gaps = 26/371 (7%) Query: 5 LDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTEGE 64 L I+G+ KR+G S+E+L+ +D+ + G FL+LVGPSGCGKSTLLN IAGL+ TEG+ Sbjct: 4 LQISGLRKRYG----SLEILKGIDLDLEQGGFLVLVGPSGCGKSTLLNTIAGLESITEGD 59 Query: 65 IRIGGKNVVGMPPRDRDIAMVFQSYALYPTLSVADNIGFALEMRKMPKPERQKRIDEVAA 124 IR+ ++ + P RDIAMVFQSYALYP ++VA NI F +EMR +P ER+ I++VA Sbjct: 60 IRVDDHSIADLHPSKRDIAMVFQSYALYPNMTVAGNIAFGMEMRGVPAEERKAAIEKVAK 119 Query: 125 MLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEMRAEIKRL 184 +LQI HLLDR+PSQLSGGQRQRVAMGRAL R P+LFLFDEPLSNLDAKLRV+MR EIKRL Sbjct: 120 VLQIGHLLDRKPSQLSGGQRQRVAMGRALVRDPKLFLFDEPLSNLDAKLRVDMRIEIKRL 179 Query: 185 HQASGITSVYVTHDQVEAMTLGSRIAVMKGGVVQQLGTPDEIYNRPANTYVATFIGSPTM 244 HQ++G T VYVTHDQ+EAMTL ++IAVMK GVVQQ GTP EIYN PAN +VA F+GSP M Sbjct: 180 HQSTGKTIVYVTHDQIEAMTLATKIAVMKDGVVQQFGTPAEIYNNPANMFVADFMGSPAM 239 Query: 245 NLLRGAVTGGQFGI-------QGAALNL-------APPPSSANEVLLGVRPEHLVMQETA 290 NLL G + G G+ GAA+ L A + +V+ G+RPE L E A Sbjct: 240 NLLSGTIERGSNGLLVSLDRAAGAAIKLPVATDKQALEAHAGRQVVFGIRPEALTDPEGA 299 Query: 291 PWRGR--------VSVVEPTGPDTYVMVDTAAGSVTLRTDAQTRVQPGEHVGLALAPAHA 342 R + VVEP G DT+ + V R A R+ G+H LA A Sbjct: 300 DRNARTLAENDCLIEVVEPAGSDTFAVTKLGGKEVVARLRADARISAGQHARLAFNLDKA 359 Query: 343 HWFDAQSEERL 353 +FD Q++ R+ Sbjct: 360 VFFDPQTQARI 370 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 371 Length adjustment: 29 Effective length of query: 326 Effective length of database: 342 Effective search space: 111492 Effective search space used: 111492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory