Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_004127637.1 RHSP_RS29440 ABC transporter ATP-binding protein
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_000359745.1:WP_004127637.1 Length = 354 Score = 364 bits (935), Expect = e-105 Identities = 196/370 (52%), Positives = 254/370 (68%), Gaps = 24/370 (6%) Query: 1 MATLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG 60 M+ LE++N+ K+YGA +TLK I++S++ GEFL+L+G SGCGKSTL+N IAGL T G Sbjct: 1 MSALEIQNIRKSYGA--LETLKGIDISLESGEFLVLLGSSGCGKSTLLNIIAGLAEATSG 58 Query: 61 AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVA 120 I IGD+ V G+ PKDRDIAMVFQSYALYP +SV NI FGL++RK+P A+ D V A Sbjct: 59 DIRIGDRSVLGVHPKDRDIAMVFQSYALYPNLSVHRNIGFGLEMRKVPAAERDKAVREAA 118 Query: 121 KLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 KLLQIE LL RKP QLSGGQ+QRVA+GRAL R+P+++LFDEPLSNLDAKLR+EMRTE+K Sbjct: 119 KLLQIEALLERKPSQLSGGQRQRVAIGRALVRKPEVFLFDEPLSNLDAKLRMEMRTELKR 178 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPP 240 +HQ LKTT VYVTHDQIEAMTL ++AVM+DG I+Q G P EIYN+PA +VA+F+G+PP Sbjct: 179 LHQMLKTTVVYVTHDQIEAMTLATRIAVMRDGRIEQLGRPDEIYNHPATLYVATFVGAPP 238 Query: 241 MNFVPLRLQRKDGRLVALLDSGQARCE-----LALNTTEAGL-EDRDVILGLRPEQIMLA 294 MN L A D G R + L + T +A + + +++++G+RPE + L Sbjct: 239 MNL-----------LNATADQGSLRIDGTSITLPMPTAKAEIKQGQELVVGIRPETLYL- 286 Query: 295 AGEGDSASSIRAEVQVTEPTGPDTLVFVQLNDTKVCCRLAPDVAPQVGETLTLQFDPSKV 354 D + A +V E TGP+ +V ++ L P G+TL L FD S + Sbjct: 287 ----DEQGQLEAVCEVAELTGPELIVTAHTGSQRLMACLPPRTTIAEGQTLKLGFDASAL 342 Query: 355 LLFDANTGER 364 LFD TG R Sbjct: 343 HLFDRATGRR 352 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 354 Length adjustment: 30 Effective length of query: 356 Effective length of database: 324 Effective search space: 115344 Effective search space used: 115344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory