Align ABC transporter permease (characterized, see rationale)
to candidate WP_004107282.1 RHSP_RS00675 sugar ABC transporter permease
Query= uniprot:A0A165KPZ4 (293 letters) >NCBI__GCF_000359745.1:WP_004107282.1 Length = 295 Score = 253 bits (647), Expect = 3e-72 Identities = 123/268 (45%), Positives = 176/268 (65%) Query: 17 PAFVLGFAFIYGLMVWNGVLSLTVSRMLPNYEWAGLAQYERLWEMDRWWVALKNLGIFGV 76 P ++ G M W+ LS T S ++P+ + G AQY +L++ RW +L+N+ IFG Sbjct: 17 PTWIAAIFVYIGTMAWSVRLSFTDSTIIPSSNYVGFAQYAKLFKNSRWLASLENVLIFGA 76 Query: 77 GYVGGSLLIGVVLAVLLDQKIRAEGALRTIYLYPMALSFVVTGTAWKWLLNPGLGIEKMV 136 YVGG L +G VLA LD+K+R E RTI+LYP A+SFVVTG W+W+LNP GI+ V Sbjct: 77 LYVGGCLALGFVLAAALDRKVRFESVFRTIFLYPYAMSFVVTGLIWQWMLNPTFGIQATV 136 Query: 137 RDWGFPNFEFGWLVDTEMAIYCVVIAGIWQSAGFAMALFLAGLRGIDDSIIKAAQVDGAS 196 R G+ F F W+V+ +MAIY VV AG+WQ AG M + L+G+RGI + KAAQ+DG Sbjct: 137 RALGWQGFVFDWIVNRDMAIYTVVFAGVWQGAGLVMVIALSGMRGISEEQWKAAQIDGIP 196 Query: 197 LPRIYWRIVLPALRPVFFSTLMVLSHLAIKSFDLVMALTAGGPGFATDVPATFMYTMSFS 256 + RIY+ I+LP L P ++ M+LS IK++DL++A T GGPG++T+VPA F+ F Sbjct: 197 VWRIYFSIILPQLGPALAASGMLLSMGVIKTYDLIVAQTGGGPGYSTEVPAKFIMDNLFE 256 Query: 257 RGQIGLGAASATMMLATVAALVIPYLYS 284 R +GL +A AT+++ +V V P+ Y+ Sbjct: 257 RQNLGLASAGATVLVLSVVMAVAPFRYA 284 Lambda K H 0.327 0.141 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 295 Length adjustment: 26 Effective length of query: 267 Effective length of database: 269 Effective search space: 71823 Effective search space used: 71823 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory