Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate WP_004124101.1 RHSP_RS23330 hypothetical protein
Query= TCDB::G4FGN4 (313 letters) >NCBI__GCF_000359745.1:WP_004124101.1 Length = 334 Score = 239 bits (610), Expect = 7e-68 Identities = 127/308 (41%), Positives = 184/308 (59%), Gaps = 8/308 (2%) Query: 9 REAGIFLILIAIVVFLGVTTREFLTVENIFTVILNVSFIAIMSFGMTMVIITSGIDLSVG 68 +E GIFL + + + L + FLT NI V+L S +++ GMT VI+T GIDLSVG Sbjct: 23 QEYGIFLAFLLLAIVLSFSNEYFLTAGNISNVLLQTSINGVLAIGMTFVILTRGIDLSVG 82 Query: 69 SILGAASVVMGLLMDEKGLS--------PFLSVVIGLAVGVGFGLANGLLITKARLAPFI 120 S++ +V + P++++ +GL VGV G GL++++ + F+ Sbjct: 83 SVVALTGIVSASFATTSATAGIVGAPYPPYVALAVGLLVGVACGAVVGLIVSRFAVPAFV 142 Query: 121 STLGMLSVGRGLAYVMSGGWPISPFPESFTVHGQGMVGPVPVPVIYMAVIGVIAHIFLKY 180 +TLGMLS RG+ + GG P+ F G G V +P+PVI +A++ ++A L Sbjct: 143 ATLGMLSAARGMTLIYGGGKPVPALTPDFRWIGTGSVLSIPMPVILLAIVFIVAWWVLNR 202 Query: 181 TVTGRRIYAIGGNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLTAWLGVAQPNAGQG 240 T GR IYA+GGN A+ GI ++ LVY I+G L+ AG +L A G A P AG Sbjct: 203 TRFGRYIYAVGGNPHAATTSGIDVSKLRFLVYVISGGLSGLAGMILAARTGSALPQAGIA 262 Query: 241 YELDVIAATVIGGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQVVIGIVIII 300 YELD IAA VIGGTSLSGG G I G +GA+I+GV+ NG+ L+G+ S++QQV+ G +I+ Sbjct: 263 YELDAIAAVVIGGTSLSGGVGRITGTLIGALIIGVMNNGLDLMGIQSYYQQVLKGTLIVG 322 Query: 301 AIAIDQIR 308 A+ +DQ R Sbjct: 323 AVMLDQKR 330 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 334 Length adjustment: 28 Effective length of query: 285 Effective length of database: 306 Effective search space: 87210 Effective search space used: 87210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory