Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate WP_004122049.1 RHSP_RS20465 carbohydrate ABC transporter permease
Query= reanno::Dino:3607127 (272 letters) >NCBI__GCF_000359745.1:WP_004122049.1 Length = 291 Score = 195 bits (495), Expect = 1e-54 Identities = 101/276 (36%), Positives = 161/276 (58%), Gaps = 7/276 (2%) Query: 4 TRSLFSQIALLVLI---ITVCVFPFYWMVTTSLKTQIVALEAPPVWI-FEPTLSNYREAL 59 TR + +++ + I + V +FP YW+ + S K I PP W+ PTL +Y EA Sbjct: 15 TREMLIRLSAYLTISVALVVTLFPIYWIASNSFKFDIDIFAVPPEWLPRNPTLKHYDEAF 74 Query: 60 FEDGVLRTLINSLIIAISTTFLALVLGVPAAFALARFEF--RGKKDLWFWFITNRMISPI 117 + LR +NS ++A+ TT +++ G A +ALARF + + +K + FW ++ RM+ PI Sbjct: 75 IQRPFLRYALNSFLVAVGTTVVSVTFGTMAGYALARFSYPWQWRKQISFWILSTRMMPPI 134 Query: 118 VLALPFFLIARNLGLLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQ 177 V +P +L +L+ LI+ Y FNLP W++ F+ +P +L+EAA ++G ++ Sbjct: 135 VSIIPLYLFFNYFDMLNTKSALIVAYTAFNLPFATWMMKSYFQDLPVELEEAAIVDGDTR 194 Query: 178 FTIMRKICLPLAMPGVAVSAIFSFIFSWNELMFGLILTRSE-AKTAPAMAVSFMEGYNLP 236 + + LPLA PG+A +AIF I SWNE + LI+T +E ++T P + YN Sbjct: 195 WGAFLHVALPLARPGLAATAIFCLIISWNEFLLSLIITLTEQSQTLPIGIAGRVTQYNTY 254 Query: 237 YGKIMATSTLIVIPVLIFALIASKQLVRGLTMGAVK 272 +G+I A + +P++IFA I K LVRGL++GAVK Sbjct: 255 WGEISAAGFMACVPIVIFAFIVQKHLVRGLSLGAVK 290 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 291 Length adjustment: 26 Effective length of query: 246 Effective length of database: 265 Effective search space: 65190 Effective search space used: 65190 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory