Align AraU, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_037152422.1 RHSP_RS16220 carbohydrate ABC transporter permease
Query= TCDB::Q97UF3 (295 letters) >NCBI__GCF_000359745.1:WP_037152422.1 Length = 287 Score = 126 bits (316), Expect = 7e-34 Identities = 80/271 (29%), Positives = 132/271 (48%), Gaps = 15/271 (5%) Query: 23 IAAILVIMWLVPLYAMILGGLKSNLEAASTPILLPPSKPSLDAYAFAWFGYATIPGLEPT 82 I ++VI + P +L + EA+ P+ P F++ Y ++ G Sbjct: 22 IGVVIVIFFFAPFAIALLSSFRHGTEASLPPL------PPWPTTGFSFDAYRSLNGFGAG 75 Query: 83 LLRY----LLVAIPSVLLSVVIGTMTAYFFFVLSEKHGIISNGLFSIMALATFLPIETVT 138 +L++ L V++ +VLL+V++ + Y F S LF ++ +P +++ Sbjct: 76 VLQHTLNSLFVSVATVLLTVIVSLLAGYGF---SRYRFPFKGALFILIIATLMIPFQSIL 132 Query: 139 FPLIELETSLNVYNTYIGLIFAMLIFYVPTSALLMSIFLPVVPKYLIESARMDGAGDWTI 198 PL + L + N+ IGL + +P S +M VPK + E+AR+DGA D + Sbjct: 133 TPLFIILARLGLNNSLIGLTLVYVTLQLPFSVFMMRNAFDAVPKEIEEAARIDGARDLKL 192 Query: 199 LWRVVFPLIFPGFLSTLIFVFLQIWNEFFIPLILTNTPNMLMLPV-AARFYTAAYALIYN 257 L+RV+FPL+ PG + IF FL WNEF L+L ++ LPV T + Sbjct: 193 LFRVLFPLVLPGVATVAIFAFLNAWNEFLAALVLLSSNEKFTLPVLMIAVRTGRLGAVNW 252 Query: 258 RSFAAGVISSLIP-LIIFIFLGRYFIRGLAA 287 + AG+ IP +I+F+ L RY++RGL A Sbjct: 253 GAVQAGIAVMTIPCVIVFLLLQRYYMRGLMA 283 Lambda K H 0.330 0.145 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 287 Length adjustment: 26 Effective length of query: 269 Effective length of database: 261 Effective search space: 70209 Effective search space used: 70209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory