Align ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized)
to candidate WP_004111334.1 RHSP_RS07045 ABC transporter permease
Query= TCDB::Q9WXW7 (317 letters) >NCBI__GCF_000359745.1:WP_004111334.1 Length = 326 Score = 219 bits (559), Expect = 5e-62 Identities = 133/304 (43%), Positives = 185/304 (60%), Gaps = 4/304 (1%) Query: 14 GPLVALVSLAVFTAILNPRFLTAFNLQALGRQIAIFGLLAIGETFVIISGGGAIDLSPGS 73 GPLV L++L VF ++ FL+ N + QI + G++A+G TFVI+ GG IDLS GS Sbjct: 25 GPLVGLLALCVFLSLSTDAFLSLRNGLNILDQITVLGIMAVGMTFVILIGG--IDLSVGS 82 Query: 74 MVALTGVMVAWLMT-HGVPVWISVILILLFSIGAGAWHGLFVTKLRVPAFIITLGTLTIA 132 ++AL +++ W G+P+ V + L+ S +G GL VT RVPAFI TL ++ A Sbjct: 83 VLALAMMVMGWTANIAGLPLVAGVAVALVASALSGLIVGLLVTLFRVPAFIATLAMMSAA 142 Query: 133 RGMAAVITKGWPIIGLPSSFLKIG-QGEFLKIPIPVWILLAVALVADFFLRKTVYGKHLR 191 RG+A +IT G I+G P F+ + F + V+++LAV A FL G+ L Sbjct: 143 RGVANMITDGQQIVGFPDWFMMLAIDRHFGVLTATVFLMLAVVAAAWVFLHFRSEGRMLY 202 Query: 192 ASGGNEVAARFSGVNVDRVRMIAFMVSGFLAGVVGIIIAARLSQGQPGVGSMYELYAIAS 251 A GGN AR +G+NV V + ++ S LAG+ GI++AARL QP G YEL IA+ Sbjct: 203 AVGGNPEVARLAGINVQLVTIAVYVASAVLAGLAGIVLAARLDSVQPSSGFGYELDTIAA 262 Query: 252 TVIGGTSLTGGEGSVLGAIVGASIISLLWNALVLLNVSTYWHNVVIGIVIVVAVTLDILR 311 VIGGTSL+GG G + G ++G II +L N L LLNVS + V+IGIVIV+AV + +R Sbjct: 263 VVIGGTSLSGGSGGIGGTLIGVLIIGVLRNGLNLLNVSPFLQQVIIGIVIVLAVGAETIR 322 Query: 312 RRLA 315 RR A Sbjct: 323 RRRA 326 Lambda K H 0.328 0.143 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 326 Length adjustment: 28 Effective length of query: 289 Effective length of database: 298 Effective search space: 86122 Effective search space used: 86122 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory