Align serine racemase (EC 5.1.1.18) (characterized)
to candidate WP_019616138.1 G327_RS0117675 threonine ammonia-lyase, biosynthetic
Query= BRENDA::O59791 (323 letters) >NCBI__GCF_000381745.1:WP_019616138.1 Length = 512 Score = 198 bits (504), Expect = 2e-55 Identities = 100/273 (36%), Positives = 166/273 (60%), Gaps = 2/273 (0%) Query: 43 VFFKCENFQKMGAFKFRGALNALSQLNEAQRKAGVLTFSSGNHAQAIALSAKILGIPAKI 102 V K E+ Q + +FK RGA N L+ L E Q++ GV+ S+GNHAQ +ALSAK +G+ A I Sbjct: 41 VLLKREDLQPVHSFKLRGAYNKLANLTEEQKQKGVIAASAGNHAQGVALSAKRMGLKATI 100 Query: 103 IMPLDAPEAKVAATKGYGGQVIMYDRYKDDREKMAKEISEREGLTIIPPYDHPHVLAGQG 162 +MP P+ KV + + G V+++ D+ KE++ + G T+IPP+D P V+AGQG Sbjct: 101 VMPRTTPDIKVNSVRALGAGVVLFGEAFDEASAHCKELAAQHGYTLIPPFDDPDVIAGQG 160 Query: 163 TAAKELFEEVGPLDALFVCLGGGGLLSGSALAARHFAPNCEVYGVEPEAGNDGQQSFRKG 222 T AKEL ++ LD +F+ +GGGGL +G A+ + P+ ++ VEPE +++ ++G Sbjct: 161 TIAKELLQQDAHLDKIFIPVGGGGLAAGIAVYIKQLLPDIKIIAVEPEDAACLKEALQQG 220 Query: 223 SIVHIDTPKTIADGAQTQHLGNYTFSIIKEKVDDILTVSDEELIDCLKFYAARMKIVVEP 282 V ++ ADG + +G TF + ++ +D+++TV+ +E+ +K + + EP Sbjct: 221 QPVTLNKVGLFADGVAVKTIGTETFRLCQKYIDEVITVNSDEICAAVKDIFDDTRAISEP 280 Query: 283 TGCLSFAAAR--AMKEKLKNKRIGIIISGGNVD 313 +G LS A + + +LKN+R+ I+SG NV+ Sbjct: 281 SGALSLAGLKKYCHQHELKNERLSAILSGANVN 313 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 512 Length adjustment: 31 Effective length of query: 292 Effective length of database: 481 Effective search space: 140452 Effective search space used: 140452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory